You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
PDE4C
cAMP-specific 3',5'-cyclic phosphodiesterase 4C

Protein Summary
Description
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262805
  • ENSP00000262805
  • ENSG00000105650
  • ENST00000447275
  • ENSP00000402091
  • ENST00000594465
  • ENSP00000470210
  • ENST00000594617
  • ENSP00000469696

Symbol
  • DPDE1
  • DPDE1
  • PDE21
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.64
protein domain
0.58
drug
0.54
tissue sample
0.54
cell line
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.3   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 206   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.3   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 206   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 81
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 7
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
DARPP-32 events (R-HSA-180024)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
DARPP-32 events
Reactome
G alpha (i) signalling events
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
Opioid Signalling
Name
Explore in Pharos
Explore in Source
DARPP-32 events
G alpha (i) signalling events
G alpha (s) signalling events
GPCR downstream signalling
Opioid Signalling
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (74)
1 – 10 of 74
AK3
Tbio
Family: Kinase
Novelty: 0.03934225
Score: 0.907
Data Source: STRINGDB
ADK
Tchem
Family: Kinase
Novelty: 0.00282266
Score: 0.904
Data Source: STRINGDB
ADSL
Tbio
Family: Enzyme
Novelty: 0.00038063
Score: 0.904
Data Source: STRINGDB
APRT
Tbio
Family: Enzyme
Novelty: 0.00447719
Score: 0.903
Data Source: STRINGDB
DCK
Tchem
Family: Kinase
Novelty: 0.00236412
Score: 0.902
Data Source: STRINGDB
ADCY9
Tbio
Family: Enzyme
Novelty: 0.0075779
Score: 0.85
Data Source: STRINGDB
ADCY6
Tchem
Family: Enzyme
Novelty: 0.0060511
Score: 0.838
Data Source: STRINGDB
ADCY5
Tchem
Family: Enzyme
Novelty: 0.00337351
Score: 0.838
Data Source: STRINGDB
ADCY10
Tchem
Family: Enzyme
Novelty: 0.00111357
Score: 0.813
Data Source: STRINGDB
ADCY8
Tbio
Family: Enzyme
Novelty: 0.00570107
Score: 0.807
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.30

PubMed score by year
PubTator Score  18.65

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKS
1-70
RLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESFLYRSDSDYELSPKAMSRNSS
70-140
VASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGAAKQGPVGNPSSSNQLPPAEDTGQKLALETL
140-210
DELDWCLDQLETLQTRHSVGEMASNKFKRILNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTA
210-280
EEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAII
280-350
FSIFQERDLLKTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA
350-420
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNLSAKQRLSLRR
420-490
MVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNLVHCADLSNPTKPLPLYRQW
490-560
TDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETWADLVHPDAQDLLDTLEDN
560-630
REWYQSKIPRSPSDLTNPERDGPDRFQFELTLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGP
630-700
DPGDLPLDNQRT
700-712
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESFLYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGAAKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRILNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLLKTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILAALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNLSAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNLVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFELTLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT