You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ADCY2
Adenylate cyclase type 2

Protein Summary
Description
Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling (PubMed:15385642). Down-stream signaling cascades mediate changes in gene expression patterns and lead to increased IL6 production. Functions in signaling cascades downstream of the muscarinic acetylcholine receptors (By similarity). This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000338316
  • ENSP00000342952
  • ENSG00000078295

Symbol
  • KIAA1060
  • AC2
  • HBAC2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.98
biological process
0.95
disease perturbation
0.95
pathway
0.84
microRNA
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.19   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 164   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.19   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 164   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (120)
Activation of GABAB receptors (R-HSA-991365)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 33
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of GABAB receptors
Reactome
Adenylate cyclase activating pathway
Reactome
Adenylate cyclase inhibitory pathway
Reactome
Aquaporin-mediated transport
Reactome
Ca-dependent events
Name
Explore in Pharos
Explore in Source
Activation of GABAB receptors
Adenylate cyclase activating pathway
Adenylate cyclase inhibitory pathway
Aquaporin-mediated transport
Ca-dependent events
Gene Ontology Terms (21)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (479)
1 – 10 of 479
GDE1
Tbio
Family: Enzyme
Novelty: 0.11583012
p_int: 0.999157181
p_ni: 0.000440346
p_wrong: 0.000402473
Score: 0.174
Data Source: BioPlex,STRINGDB
RNF181
Tbio
Family: Enzyme
Novelty: 0.33426184
p_int: 0.988876299
p_ni: 0.008494922
p_wrong: 0.002628779
Data Source: BioPlex
ANKMY2
Tdark
Novelty: 1.16129032
p_int: 0.98792767
p_ni: 0.01207233
Data Source: BioPlex
EMC7
Tdark
Novelty: 1.28514589
p_int: 0.933595103
p_ni: 0.066404886
p_wrong: 1.1e-8
Data Source: BioPlex
EMC10
Tbio
Novelty: 0.08511187
p_int: 0.903465873
p_ni: 0.087575824
p_wrong: 0.008958303
Data Source: BioPlex
SNX17
Tbio
Novelty: 0.05959005
p_int: 0.899787751
p_ni: 0.100156035
p_wrong: 0.000056214
Data Source: BioPlex
EMC8
Tdark
Novelty: 1
p_int: 0.893731687
p_ni: 0.106179764
p_wrong: 0.000088549
Data Source: BioPlex
EMC3
Tbio
Novelty: 0.01516701
p_int: 0.795857428
p_ni: 0.204142483
p_wrong: 8.8e-8
Data Source: BioPlex
GNAS
Tbio
Novelty: 0.00259764
Score: 0.978
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.978
Data Source: STRINGDB
Publication Statistics
PubMed Score  58.19

PubMed score by year
PubTator Score  155.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWQEAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLALLAVFFALGL
1-70
EVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAMGYLFMCFGGTVSPWDQVSFF
70-140
LFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSATPGGKEHLVWQILANVIIFICGNLAGAYHKH
140-210
LMELALQQTYQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHN
210-280
LYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPIS
280-350
LPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
350-420
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAKMRA
420-490
SVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQA
490-560
IDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAFKYYVTCACLIFFCIFIVQILVLPKTSVLGI
560-630
SFGAAFLLLAFILFVCFAGQLLQCSKKASPLLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFF
630-700
LSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVAL
700-770
VGYNTILLHTHAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
770-840
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGL
840-910
ECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHSQEPERQYMHIGTMVEFAFAL
910-980
VGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVL
980-1050
QTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS
1050-1091
MWQEAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLALLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAMGYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSATPGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAFKYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASPLLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFFLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHTHAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHSQEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS