You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
DDR1
Epithelial discoidin domain-containing receptor 1

Protein Summary
Description
Tyrosine kinase that functions as cell surface receptor for fibrillar collagen and regulates cell attachment to the extracellular matrix, remodeling of the extracellular matrix, cell migration, differentiation, survival and cell proliferation. Collagen binding triggers a signaling pathway that involves SRC and leads to the activation of MAP kinases. Regulates remodeling of the extracellular matrix by up-regulation of the matrix metalloproteinases MMP2, MMP7 and MMP9, and thereby facilitates cell migration and wound healing. Required for normal blastocyst implantation during pregnancy, for normal mammary gland differentiation and normal lactation. Required for normal ear morphology and normal hearing (By similarity). Promotes smooth muscle cell migration, and thereby contributes to arterial wound healing. Also plays a role in tumor cell invasion. Phosphorylates PTPN11. Receptor tyrosine kinases play a key role in the communication of cells with their microenvironment. These kinases are ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000259875
  • ENSP00000259875
  • ENSG00000137332
  • ENST00000324771
  • ENSP00000318217
  • ENSG00000204580
  • ENST00000376567
  • ENSP00000365751
  • ENST00000376568
  • ENSP00000365752
  • ENST00000376569
  • ENSP00000365753
  • ENST00000376570
  • ENSP00000365754
  • ENST00000376575
  • ENSP00000365759
  • ENST00000383377
  • ENSP00000372868
  • ENST00000400410
  • ENSP00000383261
  • ENST00000400411
  • ENSP00000383262
  • ENST00000400414
  • ENSP00000383265
  • ENST00000400486
  • ENSP00000383334
  • ENSG00000215522
  • ENST00000400488
  • ENSP00000383336
  • ENST00000400489
  • ENSP00000383337
  • ENST00000400491
  • ENSP00000383338
  • ENST00000400492
  • ENSP00000383339
  • ENST00000412329
  • ENSP00000391805
  • ENSG00000230456
  • ENST00000415092
  • ENSP00000405540
  • ENST00000418800
  • ENSP00000407699
  • ENST00000419412
  • ENSP00000416183
  • ENSG00000234078
  • ENST00000421229
  • ENSP00000415730
  • ENST00000427053
  • ENSP00000416145
  • ENST00000429699
  • ENSP00000401397
  • ENST00000430933
  • ENSP00000397769
  • ENST00000449518
  • ENSP00000414285
  • ENST00000452441
  • ENSP00000405039
  • ENST00000453510
  • ENSP00000401208
  • ENST00000454612
  • ENSP00000406091
  • ENST00000454774
  • ENSP00000400393
  • ENST00000482873
  • ENSP00000421978
  • ENST00000508312
  • ENSP00000422442
  • ENST00000513240
  • ENSP00000427552
  • ENST00000548133
  • ENSP00000449611
  • ENST00000548962
  • ENSP00000448115
  • ENST00000549026
  • ENSP00000449238
  • ENST00000550384
  • ENSP00000447474
  • ENST00000550395
  • ENSP00000449255
  • ENST00000552068
  • ENSP00000449190
  • ENST00000552721
  • ENSP00000449307
  • ENST00000553015
  • ENSP00000448377
  • ENST00000617572
  • ENSP00000479195
  • ENST00000618059
  • ENSP00000479204
  • ENST00000620318
  • ENSP00000484588
  • ENST00000621544
  • ENSP00000484013

Symbol
  • CAK
  • EDDR1
  • NEP
  • NTRK4
  • PTK3A
  • RTK6
  • TRKE
  • CAK
  • DDR
  • NEP
  • HGK2
  • PTK3
  • RTK6
  • TRKE
  • CD167
  • EDDR1
  • MCK10
  • NTRK4
  • PTK3A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
protein domain
0.99
transcription factor perturbation
0.96
disease perturbation
0.93
PubMedID
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 228.12   (req: < 5)
Gene RIFs: 103   (req: <= 3)
Antibodies: 706   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 228.12   (req: >= 5)
Gene RIFs: 103   (req: > 3)
Antibodies: 706   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 29
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 47
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 6
Protein Data Bank (11)
1 – 5 of 11
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Extracellular matrix organization (R-HSA-1474244)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Extracellular matrix organization
Reactome
Non-integrin membrane-ECM interactions
Name
Explore in Pharos
Explore in Source
Extracellular matrix organization
Non-integrin membrane-ECM interactions
Gene Ontology Terms (35)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (39)
1 – 10 of 39
EVA1B
Tdark
Novelty: 3
p_int: 0.996244793
p_ni: 0.003699583
p_wrong: 0.000055624
Data Source: BioPlex
TNFRSF10B
Tbio
Novelty: 0.0006573
p_int: 0.965955183
p_ni: 0.000506309
p_wrong: 0.033538509
Score: 0.226
Data Source: BioPlex,STRINGDB
TM4SF1
Tbio
Novelty: 0.01809108
Score: 0.693
Data Source: STRINGDB
COL3A1
Tbio
Novelty: 0.00231183
Score: 0.692
Data Source: STRINGDB
COL5A1
Tbio
Novelty: 0.0078384
Score: 0.67
Data Source: STRINGDB
ITGA2
Tbio
Novelty: 0.0018496
Score: 0.653
Data Source: STRINGDB
COL2A1
Tbio
Novelty: 0.00119609
Score: 0.619
Data Source: STRINGDB
COL4A1
Tbio
Novelty: 0.00485546
Score: 0.59
Data Source: STRINGDB
CYSTM1
Tdark
Novelty: 7
Score: 0.559
Data Source: STRINGDB
NOTCH1
Tchem
Novelty: 0.00014278
Score: 0.552
Data Source: STRINGDB
Publication Statistics
PubMed Score  228.12

PubMed score by year
PubTator Score  168.72

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGD
1-70
GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEV
70-140
ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYL
140-210
NDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAF
210-280
QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRF
280-350
LFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
350-420
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPR
420-490
GNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPP
490-560
PPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVD
560-630
SPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMI
630-700
TDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATR
700-770
NCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC
770-840
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL
840-910
NTV
910-913
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILIGCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV