You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CKAP4
Cytoskeleton-associated protein 4

Protein Summary
Description
High-affinity epithelial cell surface receptor for APF. Mediates the anchoring of the endoplasmic reticulum to microtubules.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378026
  • ENSP00000367265
  • ENSG00000136026

Symbol
  • p63
  • CLIMP-63
  • ERGIC-63
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
virus perturbation
0.95
transcription factor perturbation
0.94
ligand (protein) perturbation
0.83
cellular component
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.28   (req: < 5)
Gene RIFs: 42   (req: <= 3)
Antibodies: 260   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.28   (req: >= 5)
Gene RIFs: 42   (req: > 3)
Antibodies: 260   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Immune System (R-HSA-168256)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Metabolism of proteins
Reactome
Neutrophil degranulation
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Immune System
Innate Immune System
Metabolism of proteins
Neutrophil degranulation
Post-translational protein modification
Gene Ontology Terms (21)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (326)
1 – 10 of 326
PRELP
Tbio
Novelty: 0.02432434
p_int: 0.999415611
p_ni: 0.000584389
Score: 0.179
Data Source: BioPlex,STRINGDB
SEMA7A
Tbio
Novelty: 0.00800866
p_int: 0.998588278
p_ni: 0.001411722
Data Source: BioPlex
RGS3
Tbio
Novelty: 0.02080749
p_int: 0.998075308
p_ni: 0.001924692
Data Source: BioPlex
B3GAT3
Tbio
Family: Enzyme
Novelty: 0.03234252
p_int: 0.994818867
p_ni: 0.005181133
Score: 0.278
Data Source: BioPlex,STRINGDB
IPPK
Tbio
Family: Enzyme
Novelty: 0.04063664
p_int: 0.987505098
p_ni: 0.012494902
Data Source: BioPlex
MED21
Tbio
Family: Enzyme
Novelty: 0.07350796
p_int: 0.978285265
p_ni: 0.021714735
Data Source: BioPlex
LPAR1
Tchem
Family: GPCR
Novelty: 0.004102
p_int: 0.974207882
p_ni: 0.025792118
Data Source: BioPlex
LYPD3
Tbio
Novelty: 0.0363726
p_int: 0.967476186
p_ni: 0.032523814
Data Source: BioPlex
FBXO28
Tbio
Novelty: 0.12833512
p_int: 0.963534778
p_ni: 0.036465222
Data Source: BioPlex
CYB5B
Tbio
Novelty: 0.11412954
p_int: 0.94578393
p_ni: 0.05421607
Data Source: BioPlex
Publication Statistics
PubMed Score  37.28

PubMed score by year
PubTator Score  38.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGKGGHR
1-70
GGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAAAFSGWCVHHVLEEVQQVRRS
70-140
HQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQHKQDLTEKAVKQGESEVSRISEVLQKLQNE
140-210
ILKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESE
210-280
GNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQ
280-350
ALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGV
350-420
LSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELK
420-490
RSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSL
490-560
VAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV
560-602
MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGKGGHRGGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAAAFSGWCVHHVLEEVQQVRRSHQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQHKQDLTEKAVKQGESEVSRISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV