You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TYRO3
Tyrosine-protein kinase receptor TYRO3

Protein Summary
Description
Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to several ligands including TULP1 or GAS6. Regulates many physiological processes including cell survival, migration and differentiation. Ligand binding at the cell surface induces dimerization and autophosphorylation of TYRO3 on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with PIK3R1 and thereby enhances PI3-kinase activity. Activates the AKT survival pathway, including nuclear translocation of NF-kappa-B and up-regulation of transcription of NF-kappa-B-regulated genes. TYRO3 signaling plays a role in various processes such as neuron protection from excitotoxic injury, platelet aggregation and cytoskeleton reorganization. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppre ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263798
  • ENSP00000263798
  • ENSG00000092445

Symbol
  • BYK
  • DTK
  • RSE
  • SKY
  • TIF
  • BYK
  • Dtk
  • RSE
  • Rek
  • Sky
  • Tif
  • Etk-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
molecular function
0.99
PubMedID
0.9
biological process
0.89
transcription factor binding site profile
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 961.04   (req: < 5)
Gene RIFs: 42   (req: <= 3)
Antibodies: 644   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 961.04   (req: >= 5)
Gene RIFs: 42   (req: > 3)
Antibodies: 644   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 35
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 30
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Ebola Virus Pathway on Host
WikiPathways
Ebola Virus Pathway on Host
WikiPathways
Ebola Virus Pathway on Host
WikiPathways
Ebola Virus Pathway on Host
WikiPathways
LncRNA involvement in canonical Wnt signaling and colorectal cancer
Name
Explore in Pharos
Explore in Source
Ebola Virus Pathway on Host
Ebola Virus Pathway on Host
Ebola Virus Pathway on Host
Ebola Virus Pathway on Host
LncRNA involvement in canonical Wnt signaling and colorectal cancer
Gene Ontology Terms (42)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (48)
1 – 10 of 48
CHRNB3
Tchem
Family: IC
Novelty: 0.04622453
p_int: 0.999999978
p_ni: 2.1e-8
Score: 0.569
Data Source: BioPlex,STRINGDB
LPAR1
Tchem
Family: GPCR
Novelty: 0.004102
p_int: 0.999999296
p_ni: 7.03e-7
Score: 0.167
Data Source: BioPlex,STRINGDB
IPPK
Tbio
Family: Enzyme
Novelty: 0.04063664
p_int: 0.999997449
p_ni: 0.000002541
p_wrong: 1e-8
Data Source: BioPlex
TMEM30B
Tbio
Novelty: 0.41265163
p_int: 0.999983894
p_ni: 0.000016032
p_wrong: 7.5e-8
Data Source: BioPlex
GAS6
Tbio
Novelty: 0.00291371
Score: 0.912
Data Source: STRINGDB
PROS1
Tbio
Novelty: 0.00099472
Score: 0.816
Data Source: STRINGDB
GP2
Tbio
Novelty: 0.00213339
Score: 0.744
Data Source: STRINGDB
SOCS1
Tbio
Novelty: 0.0006161
Score: 0.664
Data Source: STRINGDB
NPC1
Tbio
Novelty: 0.00185593
Score: 0.637
Data Source: STRINGDB
CLEC4G
Tbio
Novelty: 0.06970762
Score: 0.63
Data Source: STRINGDB
Publication Statistics
PubMed Score  961.04

PubMed score by year
PubTator Score  164.45

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPVKLNCSVEGME
1-70
EPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPF
70-140
FTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKG
140-210
LASSRTATVHLQALPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPP
210-280
FTCLLRDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAP
280-350
LEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQ
350-420
GPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
420-490
IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASS
490-560
DIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQ
560-630
TLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLA
630-700
LESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWS
700-770
ADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAV
770-840
GGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC
840-890
MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPLEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC