You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MEF2C
Myocyte-specific enhancer factor 2C

Protein Summary
Description
Transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B-lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B-cells. May also be involved in neurogenesis and in the development of cortical architecture (By similarity). Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isofor ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340208
  • ENSP00000340874
  • ENSG00000081189
  • ENST00000424173
  • ENSP00000389610
  • ENST00000437473
  • ENSP00000396219
  • ENST00000504921
  • ENSP00000421925
  • ENST00000508569
  • ENSP00000423597
  • ENST00000514015
  • ENSP00000424606
  • ENST00000514028
  • ENSP00000426665
  • ENST00000625674
  • ENSP00000487430
  • ENST00000628656
  • ENSP00000487311
  • ENST00000629612
  • ENSP00000486554
  • ENST00000636294
  • ENSP00000490473
  • ENST00000636998
  • ENSP00000490630
  • ENST00000637732
  • ENSP00000490241

Symbol
  • DEL5q14.3
  • C5DELq14.3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
1
kinase
0.93
transcription factor perturbation
0.91
disease perturbation
0.9


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 330.6   (req: < 5)
Gene RIFs: 91   (req: <= 3)
Antibodies: 1196   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 330.6   (req: >= 5)
Gene RIFs: 91   (req: > 3)
Antibodies: 1196   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 109
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (77)
Circadian Clock (R-HSA-400253)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 40
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Circadian Clock
Reactome
Cytokine Signaling in Immune system
Reactome
Developmental Biology
Reactome
ERK/MAPK targets
Reactome
Gene expression (Transcription)
Name
Explore in Pharos
Explore in Source
Circadian Clock
Cytokine Signaling in Immune system
Developmental Biology
ERK/MAPK targets
Gene expression (Transcription)
Gene Ontology Terms (119)
Items per page:
10
1 – 10 of 16
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (256)
1 – 10 of 256
MEF2B
Tbio
Family: TF
Novelty: 0.02665536
p_int: 0.999997108
p_wrong: 0.000002891
Data Source: BioPlex
GATA4
Tbio
Family: TF
Novelty: 0.00115226
Score: 0.993
Data Source: STRINGDB
NKX2-5
Tbio
Family: TF
Novelty: 0.00147966
Score: 0.991
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.988
Data Source: STRINGDB
MYOG
Tbio
Family: TF
Novelty: 0.00099383
Score: 0.988
Data Source: Reactome,STRINGDB
MYOD1
Tbio
Family: TF
Novelty: 0.00064991
Score: 0.987
Data Source: Reactome,STRINGDB
MAPK7
Tchem
Family: Kinase
Novelty: 0.00301243
Score: 0.987
Data Source: Reactome,STRINGDB
CREBBP
Tchem
Family: Epigenetic
Novelty: 0.00127032
Score: 0.98
Data Source: STRINGDB
HAND2
Tbio
Family: TF
Novelty: 0.00439742
Score: 0.98
Data Source: STRINGDB
HDAC4
Tclin
Family: Epigenetic
Novelty: 0.00271036
Score: 0.979
Data Source: STRINGDB
Publication Statistics
PubMed Score  330.60

PubMed score by year
PubTator Score  179.68

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYT
1-70
EYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPN
70-140
FEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGT
140-210
SAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQ
210-280
RINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGW
280-350
QQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
350-420
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
420-473
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT