You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RBPJ
Recombining binding protein suppressor of hairless

Protein Classes
Protein Summary
Description
Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes. Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins, respectively. Specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. Binds specifically to methylated DNA (PubMed:21991380). Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen) (PubMed:23303788). Negatively regulates the phagocyte oxidative burst in response to bacterial infection by ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000342295
  • ENSP00000345206
  • ENSG00000168214
  • ENST00000342320
  • ENSP00000340124
  • ENST00000345843
  • ENSP00000305815
  • ENST00000348160
  • ENSP00000339699
  • ENST00000355476
  • ENSP00000347659
  • ENST00000361572
  • ENSP00000354528
  • ENST00000507561
  • ENSP00000423907

Symbol
  • IGKJRB
  • IGKJRB1
  • RBPJK
  • RBPSUH
  • SUH
  • csl
  • AOS3
  • CBF1
  • KBF2
  • RBP-J
  • RBPJK
  • IGKJRB
  • RBPSUH
  • IGKJRB1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
disease perturbation
1
molecular function
0.97
transcription factor binding site profile
0.96
transcription factor
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 459.31   (req: < 5)
Gene RIFs: 87   (req: <= 3)
Antibodies: 332   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 459.31   (req: >= 5)
Gene RIFs: 87   (req: > 3)
Antibodies: 332   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 68
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (49)
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 28
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Reactome
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Reactome
Developmental Biology
Reactome
Disease
Reactome
Diseases of signal transduction
Name
Explore in Pharos
Explore in Source
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Developmental Biology
Disease
Diseases of signal transduction
Gene Ontology Terms (75)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
CAFA
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (227)
1 – 10 of 227
MAML1
Tbio
Novelty: 0.0200407
p_int: 1
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
FBXO42
Tbio
Novelty: 0.01292089
p_int: 1
Score: 0.567
Data Source: BioPlex,STRINGDB
ZNF268
Tbio
Family: TF
Novelty: 0.04368175
p_int: 0.999996036
p_ni: 0.000003952
p_wrong: 1.1e-8
Score: 0.538
Data Source: BioPlex,STRINGDB
WDR70
Tdark
Novelty: 1.2244898
p_int: 0.999992194
p_ni: 0.000007801
p_wrong: 5e-9
Score: 0.575
Data Source: BioPlex,STRINGDB
SPEN
Tbio
Novelty: 0.00416868
p_int: 0.999986787
p_ni: 0.000013213
Score: 0.979
Data Source: BioPlex,STRINGDB
NOTCH1
Tchem
Novelty: 0.00014278
p_int: 0.999963247
p_ni: 0.000036694
p_wrong: 5.8e-8
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
ZNF589
Tbio
Family: TF
Novelty: 0.36511156
p_int: 0.999960979
p_ni: 0.000002787
p_wrong: 0.000036234
Score: 0.255
Data Source: BioPlex,STRINGDB
EIF1AD
Tdark
Novelty: 0.26086957
p_int: 0.999894352
p_ni: 0.000105307
p_wrong: 3.41e-7
Data Source: BioPlex
NSMF
Tbio
Novelty: 0.08368201
p_int: 0.999841019
p_ni: 0.00015898
p_wrong: 1e-9
Score: 0.237
Data Source: BioPlex,STRINGDB
RNF7
Tbio
Novelty: 0.03533891
p_int: 0.999779836
p_ni: 0.000026236
p_wrong: 0.000193928
Data Source: BioPlex
Publication Statistics
PubMed Score  459.31

PubMed score by year
PubTator Score  346.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPP
1-70
PCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFM
70-140
LSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNF
140-210
HASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPV
210-280
SQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAP
280-350
VTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
350-420
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTS
420-490
VTSSTATVVS
490-500
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS