You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
GFPT1
Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1

Protein Classes
Protein Summary
Description
Controls the flux of glucose into the hexosamine pathway. Most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins. Regulates the circadian expression of clock genes ARNTL/BMAL1 and CRY1. This gene encodes the first and rate-limiting enzyme of the hexosamine pathway and controls the flux of glucose into the hexosamine pathway. The product of this gene catalyzes the formation of glucosamine 6-phosphate. [provided by RefSeq, Sep 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000357308
  • ENSP00000349860
  • ENSG00000198380
  • ENST00000361060
  • ENSP00000354347

Symbol
  • GFAT
  • GFPT
  • GFA
  • GFAT
  • GFPT
  • MSLG
  • CMS12
  • GFAT1
  • CMSTA1
  • GFAT 1
  • GFAT1m
  • GFPT1L
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.99
biological process
0.98
interacting protein
0.93
kinase perturbation
0.93
ligand (protein) perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 622.69   (req: < 5)
Gene RIFs: 33   (req: <= 3)
Antibodies: 206   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 622.69   (req: >= 5)
Gene RIFs: 33   (req: > 3)
Antibodies: 206   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (24)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Reactome
Defective GFPT1 causes CMSTA1
Reactome
Disease
Reactome
Diseases associated with glycosylation precursor biosynthesis
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Defective GFPT1 causes CMSTA1
Disease
Diseases associated with glycosylation precursor biosynthesis
Protein-Protein Interactions (118)
1 – 10 of 118
GFPT2
Tbio
Family: Enzyme
Novelty: 0.01502986
p_int: 0.99998585
p_ni: 0.00001415
Score: 0.966
Data Source: BioPlex,STRINGDB
LRP1
Tbio
Novelty: 0.00117899
p_int: 0.853075636
p_ni: 0.146924364
Score: 0.595
Data Source: BioPlex,STRINGDB
GNPNAT1
Tbio
Family: Enzyme
Novelty: 0.02904729
Score: 0.981
Data Source: STRINGDB
CAD
Tchem
Novelty: 0.00769545
Score: 0.968
Data Source: STRINGDB
GPI
Tbio
Family: Enzyme
Novelty: 0.00073017
Score: 0.964
Data Source: STRINGDB
HK1
Tchem
Family: Kinase
Novelty: 0.00089993
Score: 0.962
Data Source: STRINGDB
MPI
Tchem
Family: Enzyme
Novelty: 0.00966817
Score: 0.955
Data Source: STRINGDB
GLUL
Tchem
Family: Enzyme
Novelty: 0.00112575
Score: 0.952
Data Source: STRINGDB
PPAT
Tclin
Family: Enzyme
Novelty: 0.01923397
Score: 0.938
Data Source: STRINGDB
HK2
Tchem
Family: Kinase
Novelty: 0.00222818
Score: 0.937
Data Source: STRINGDB
Publication Statistics
PubMed Score  622.69

PubMed score by year
PubTator Score  158.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKIQLIKKKGKVKALD
1-70
EEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKG
70-140
YDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIG
140-210
VRSEHKLSTDHIPILYRTARTQIGSKFTRWGSQGERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASD
210-280
ASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQ
280-350
PESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELAS
350-420
DFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGV
420-490
ASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLI
490-560
MGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVAR
560-630
QGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
630-699
MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKIQLIKKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTARTQIGSKFTRWGSQGERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE