You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CHRNB3
Neuronal acetylcholine receptor subunit beta-3

Protein Classes
Protein Summary
Description
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are (hetero)pentamers composed of homologous subunits. The subunits that make up the muscle and neuronal forms of nAChRs are encoded by separate genes and have different primary structure. There are several subtypes of neuronal nAChRs that vary based on which homologous subunits are arranged around the central channel. They are classified as alpha-subunits if, like muscle alpha-1 (MIM 100690), they have a pair of adjacent cysteines as part of the presumed acetylcholine binding site. Subunits lacking these cysteine residues are classified as beta-subunits (Groot Kormelink and Luyten, 1997 [PubMed 9009220]). Elliott et al. (1996) [PubMed ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000289957
  • ENSP00000289957
  • ENSG00000147432
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.88
protein domain
0.85
tissue
0.64
cell line
0.62
cell type or tissue
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.3   (req: < 5)
Gene RIFs: 33   (req: <= 3)
Antibodies: 159   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.3   (req: >= 5)
Gene RIFs: 33   (req: > 3)
Antibodies: 159   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
nicotine
chemical structure image
Pathways (11)
Acetylcholine binding and downstream events (R-HSA-181431)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine binding and downstream events
Reactome
Highly calcium permeable nicotinic acetylcholine receptors
Reactome
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Name
Explore in Pharos
Explore in Source
Acetylcholine binding and downstream events
Highly calcium permeable nicotinic acetylcholine receptors
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Protein-Protein Interactions (41)
1 – 10 of 41
TYRO3
Tchem
Family: Kinase
Novelty: 0.00134222
p_int: 0.999999978
p_ni: 2.1e-8
Score: 0.569
Data Source: BioPlex,STRINGDB
LEMD2
Tdark
Novelty: 0.1754386
p_int: 0.979008265
p_ni: 0.020991735
Score: 0.224
Data Source: BioPlex,STRINGDB
CHRNA7
Tchem
Family: IC
Novelty: 0.00717396
Score: 0.922
Data Source: STRINGDB
CHRNA6
Tchem
Family: IC
Novelty: 0.05805561
Score: 0.914
Data Source: Reactome,STRINGDB
CHRNB2
Tclin
Family: IC
Novelty: 0.02119739
Score: 0.911
Data Source: STRINGDB
CHRNA4
Tclin
Family: IC
Novelty: 0.00260286
Score: 0.91
Data Source: Reactome,STRINGDB
CHRNA9
Tchem
Family: IC
Novelty: 0.07858477
Score: 0.909
Data Source: STRINGDB
CHRNA2
Tchem
Family: IC
Novelty: 0.03966016
Score: 0.908
Data Source: Reactome,STRINGDB
CHRNB4
Tclin
Family: IC
Novelty: 0.02388015
Score: 0.908
Data Source: Reactome,STRINGDB
CHRNA3
Tclin
Family: IC
Novelty: 0.00918226
Score: 0.908
Data Source: STRINGDB
Publication Statistics
PubMed Score  22.30

PubMed score by year
PubTator Score  21.42

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDE
1-70
KNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGT
70-140
VVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMK
140-210
GNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLL
210-280
VIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMK
280-350
DHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK
350-420
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH
420-458
MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWKFVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH