You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GAD2
Glutamate decarboxylase 2

Protein Summary
Description
Catalyzes the production of GABA. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000259271
  • ENSP00000259271
  • ENSG00000136750
  • ENST00000376261
  • ENSP00000365437

Symbol
  • GAD65
  • GAD65
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
phosphatase
0.98
trait
0.93
cellular component
0.92
disease
0.85
molecular function
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1120.68   (req: < 5)
Gene RIFs: 84   (req: <= 3)
Antibodies: 650   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1120.68   (req: >= 5)
Gene RIFs: 84   (req: > 3)
Antibodies: 650   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (27)
GABA synthesis (R-HSA-888568)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
GABA synthesis
Reactome
GABA synthesis, release, reuptake and degradation
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
MECP2 regulates transcription of genes involved in GABA signaling
Name
Explore in Pharos
Explore in Source
GABA synthesis
GABA synthesis, release, reuptake and degradation
Gene expression (Transcription)
Generic Transcription Pathway
MECP2 regulates transcription of genes involved in GABA signaling
Protein-Protein Interactions (280)
1 – 10 of 280
SLC32A1
Tchem
Family: Transporter
Novelty: 0.00247724
Score: 0.994
Data Source: STRINGDB
ABAT
Tclin
Family: Enzyme
Novelty: 0.00944717
Score: 0.982
Data Source: STRINGDB
SNAP25
Tclin
Novelty: 0.0020914
Score: 0.967
Data Source: STRINGDB
SYT1
Tbio
Novelty: 0.00202951
Score: 0.957
Data Source: STRINGDB
GAD1
Tbio
Family: Enzyme
Novelty: 0.00102125
Score: 0.956
Data Source: Reactome,STRINGDB
PTPRN
Tbio
Family: Enzyme
Novelty: 0.00120688
Score: 0.949
Data Source: STRINGDB
GLUL
Tchem
Family: Enzyme
Novelty: 0.00112575
Score: 0.949
Data Source: STRINGDB
VAMP2
Tbio
Novelty: 0.00274235
Score: 0.947
Data Source: STRINGDB
STX1A
Tbio
Novelty: 0.00128938
Score: 0.943
Data Source: STRINGDB
GLS2
Tbio
Family: Enzyme
Novelty: 0.00145737
Score: 0.937
Data Source: STRINGDB
Publication Statistics
PubMed Score  1120.68

PubMed score by year
PubTator Score  842.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGGSQPPRAAARK
1-70
AACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNE
70-140
LLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIA
140-210
PVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEH
210-280
SHFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAV
280-350
ADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
350-420
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREG
420-490
YEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMV
490-560
ISNPAATHQDIDFLIEEIERLGQDL
560-585
MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGGSQPPRAAARKAACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEHSHFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL