You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ACVR1
Activin receptor type-1

Protein Summary
Description
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis (By similarity). Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors ar ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263640
  • ENSP00000263640
  • ENSG00000115170
  • ENST00000409283
  • ENSP00000387273
  • ENST00000410057
  • ENSP00000387127
  • ENST00000434821
  • ENSP00000405004

Symbol
  • ACVRLK2
  • FOP
  • ALK2
  • SKR1
  • TSRI
  • ACTRI
  • ACVR1A
  • ACVRLK2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
biological process
0.99
disease perturbation
0.97
protein domain
0.92
hub protein
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 317.67   (req: < 5)
Gene RIFs: 84   (req: <= 3)
Antibodies: 539   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 317.67   (req: >= 5)
Gene RIFs: 84   (req: > 3)
Antibodies: 539   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 57
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 19
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (13)
1 – 5 of 13
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (192)
Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
TGF-beta signaling pathway
KEGG
Signaling pathways regulating pluripotency of stem cells
KEGG
Fluid shear stress and atherosclerosis
KEGG
Cytokine-cytokine receptor interaction
Name
Explore in Pharos
Explore in Source
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells
Fluid shear stress and atherosclerosis
Cytokine-cytokine receptor interaction
Gene Ontology Terms (61)
Items per page:
10
1 – 10 of 15
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (115)
1 – 10 of 115
LRRIQ1
Tdark
p_int: 0.999884701
p_ni: 0.000040716
p_wrong: 0.000074584
Score: 0.593
Data Source: BioPlex,STRINGDB
TNFRSF10A
Tchem
Novelty: 0.0003938
p_int: 0.999864716
p_ni: 0.000077564
p_wrong: 0.00005772
Score: 0.663
Data Source: BioPlex,STRINGDB
TGFBRAP1
Tbio
Novelty: 0.09004245
p_int: 0.963769973
p_ni: 0.03622065
p_wrong: 0.000009378
Score: 0.294
Data Source: BioPlex,STRINGDB
BMPR1A
Tchem
Family: Kinase
Novelty: 0.00472897
p_int: 0.949442782
p_ni: 0.050554372
p_wrong: 0.000002846
Score: 0.933
Data Source: BioPlex,STRINGDB
BMPR2
Tchem
Family: Kinase
Novelty: 0.00191079
p_int: 0.94729335
p_ni: 0.000047646
p_wrong: 0.052659005
Score: 0.991
Data Source: BioPlex,STRINGDB
RNF149
Tdark
Family: Enzyme
Novelty: 0.47955733
p_int: 0.93758666
p_ni: 0.062223718
p_wrong: 0.000189622
Score: 0.643
Data Source: BioPlex,STRINGDB
MRAP2
Tbio
Novelty: 0.05863056
p_int: 0.93482703
p_ni: 0.000051895
p_wrong: 0.065121075
Score: 0.531
Data Source: BioPlex,STRINGDB
GRAMD1A
Tdark
Novelty: 0.3099631
p_int: 0.898234711
p_ni: 0.101765286
p_wrong: 2e-9
Score: 0.152
Data Source: BioPlex,STRINGDB
ACVRL1
Tchem
Family: Kinase
Novelty: 0.00374091
p_int: 0.874917456
p_ni: 8e-9
p_wrong: 0.125082536
Score: 0.546
Data Source: BioPlex,STRINGDB
CD320
Tbio
Novelty: 0.03078608
p_int: 0.857411228
p_ni: 0.142587369
p_wrong: 0.000001402
Score: 0.739
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  317.67

PubMed score by year
PubTator Score  213.98

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC
1-70
FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLAC
70-140
LLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITL
140-210
LECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLW
210-280
LITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQC
280-350
CIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
350-420
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALR
420-490
IKKTLTKIDNSLDKLKTDC
490-509
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC