You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EVX2
Homeobox even-skipped homolog protein 2

Protein Summary
Description
This gene is located at the 5' end of the HOXD gene cluster on chromosome 2. The encoded protein is a homeobox transcription factor that is related to the protein encoded by the Drosophila even-skipped (eve) gene, a member of the pair-rule class of segmentation genes. A 117 kb microdeletion at the 5' end of the HOXD gene cluster, which includes this gene and the HOXD9-HOXD13 genes, causes synpolydactyly, a dominantly inherited disease resulting in limb malformation. [provided by RefSeq, Sep 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000308618
  • ENSP00000312385
  • ENSG00000174279

Symbol
  • EVX-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue
0.6
protein domain
0.58
PubMedID
0.56
transcription factor binding site profile
0.42
chemical
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.01   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 138   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.01   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 138   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (23)
1 – 10 of 23
LNPK
Tbio
Novelty: 0.06984866
Score: 0.751
Data Source: STRINGDB
MTX2
Tbio
Novelty: 0.02415503
Score: 0.711
Data Source: STRINGDB
ITIH6
Tdark
Novelty: 12
Score: 0.702
Data Source: STRINGDB
SKOR2
Tdark
Novelty: 0.25916715
Score: 0.606
Data Source: STRINGDB
SPOP
Tbio
Novelty: 0.00958399
Score: 0.543
Data Source: STRINGDB
ATP5S
Tdark
Family: Enzyme
Novelty: 0.4137931
Score: 0.513
Data Source: STRINGDB
BPIFB3
Tdark
Novelty: 0.40133779
Score: 0.513
Data Source: STRINGDB
SPERT
Tbio
Novelty: 0.04642166
Score: 0.474
Data Source: STRINGDB
NR2E1
Tbio
Family: NR
Novelty: 0.02124787
Score: 0.472
Data Source: STRINGDB
GAL3ST3
Tdark
Family: Enzyme
Novelty: 0.38709677
Score: 0.472
Data Source: STRINGDB
Publication Statistics
PubMed Score  14.01

PubMed score by year
PubTator Score  9.06

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMERIRKEMILMERGLHSPTAGKRFSNLSNSAGNAVLEALENSQHPARLSPRLPSAPLHSALGELPAKGK
1-70
FEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYSEAAAEADMSSDVEVGCSALRSPGGLGAAQLKENN
70-140
GKGYAESGSAAGTTTSASGSGLGSLHGGSGGSGGSAALGGSGSGADQVRRYRTAFTREQIARLEKEFYRE
140-210
NYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMSWPHPADPSFYTYMMTHAAATGSLPYPFHS
210-280
HVPLHYYPHVGVTAAAAAAAASGAAAAASSPFATSIRPLDTFRALSHPYSRPELLCSFRHPGLYQAPAAA
280-350
AGLNSAASAAAAAAAAAAAASSAAAAGAPPSGGSAPCSCLSCHSSQSAAAAAAAAAAALGSRGGGGGGGG
350-420
GGGGGGGGAGAGGGSDFGCSAAAPRSESGFLPYSAAVLSKTAVSPPDQRDEAPLTR
420-476
MMERIRKEMILMERGLHSPTAGKRFSNLSNSAGNAVLEALENSQHPARLSPRLPSAPLHSALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYSEAAAEADMSSDVEVGCSALRSPGGLGAAQLKENNGKGYAESGSAAGTTTSASGSGLGSLHGGSGGSGGSAALGGSGSGADQVRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMSWPHPADPSFYTYMMTHAAATGSLPYPFHSHVPLHYYPHVGVTAAAAAAAASGAAAAASSPFATSIRPLDTFRALSHPYSRPELLCSFRHPGLYQAPAAAAGLNSAASAAAAAAAAAAAASSAAAAGAPPSGGSAPCSCLSCHSSQSAAAAAAAAAAALGSRGGGGGGGGGGGGGGGGAGAGGGSDFGCSAAAPRSESGFLPYSAAVLSKTAVSPPDQRDEAPLTR