You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TNFAIP2
Tumor necrosis factor alpha-induced protein 2

Protein Classes
Protein Summary
Description
May play a role as a mediator of inflammation and angiogenesis. This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. The expression of this gene was shown to be induced by retinoic acid in a cell line expressing a oncogenic version of the retinoic acid receptor alpha fusion protein, which suggested that this gene may be a retinoic acid target gene in acute promyelocytic leukemia. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000333007
  • ENSP00000332326
  • ENSG00000185215
  • ENST00000560869
  • ENSP00000452634

Symbol
  • B94
  • EXOC3L3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
gene perturbation
0.92
kinase perturbation
0.84
transcription factor perturbation
0.84
PubMedID
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 68.95   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 176   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 68.95   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 176   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (49)
1 – 10 of 49
EXOC7
Tbio
Novelty: 0.01322945
Score: 0.872
Data Source: STRINGDB
EXOC2
Tbio
Novelty: 0.01798053
Score: 0.822
Data Source: STRINGDB
EXOC8
Tbio
Novelty: 0.06047806
Score: 0.816
Data Source: STRINGDB
EXOC5
Tbio
Novelty: 0.03153548
Score: 0.81
Data Source: STRINGDB
EXOC4
Tbio
Novelty: 0.02000189
Score: 0.808
Data Source: STRINGDB
EXOC1
Tbio
Novelty: 0.01279762
Score: 0.716
Data Source: STRINGDB
EXOC6
Tbio
Novelty: 0.02897817
Score: 0.691
Data Source: STRINGDB
EXOC6B
Tbio
Novelty: 0.15037594
Score: 0.691
Data Source: STRINGDB
STXBP6
Tbio
Novelty: 0.18615646
Score: 0.59
Data Source: STRINGDB
EXOC3
Tbio
Novelty: 0.01423005
Score: 0.58
Data Source: STRINGDB
Publication Statistics
PubMed Score  68.95

PubMed score by year
PubTator Score  31.04

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSEASSEDLVPPLEAGAAPYREEEEAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQ
1-70
GLDGPPPTVEELKAALERGQLEAARPLLALERELAAAAAAGGVSEEELVRRQSKVEALYELLRDQVLGVL
70-140
RRPLEAPPERLRQALAVVAEQEREDRQAAAAGPGTSGLAATRPRRWLQLWRRGVAEAAEERMGQRPAAGA
140-210
EVPESVFLHLGRTMKEDLEAVVERLKPLFPAEFGVVAAYAESYHQHFAAHLAAVAQFELCERDTYMLLLW
210-280
VQNLYPNDIINSPKLVGELQGMGLGSLLPPRQIRLLEATFLSSEAANVRELMDRALELEARRWAEDVPPQ
280-350
RLDGHCHSELAIDIIQITSQAQAKAESITLDLGSQIKRVLLVELPAFLRSYQRAFNEFLERGKQLTNYRA
350-420
NVIANINNCLSFRMSMEQNWQVPQDTLSLLLGPLGELKSHGFDTLLQNLHEDLKPLFKRFTHTRWAAPVE
420-490
TLENIIATVDTRLPEFSELQGCFREELMEALHLHLVKEYIIQLSKGRLVLKTAEQQQQLAGYILANADTI
490-560
QHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRI
560-630
RSILDVSMGAQEPSRPLFSLIKVG
630-654
MSEASSEDLVPPLEAGAAPYREEEEAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQGLDGPPPTVEELKAALERGQLEAARPLLALERELAAAAAAGGVSEEELVRRQSKVEALYELLRDQVLGVLRRPLEAPPERLRQALAVVAEQEREDRQAAAAGPGTSGLAATRPRRWLQLWRRGVAEAAEERMGQRPAAGAEVPESVFLHLGRTMKEDLEAVVERLKPLFPAEFGVVAAYAESYHQHFAAHLAAVAQFELCERDTYMLLLWVQNLYPNDIINSPKLVGELQGMGLGSLLPPRQIRLLEATFLSSEAANVRELMDRALELEARRWAEDVPPQRLDGHCHSELAIDIIQITSQAQAKAESITLDLGSQIKRVLLVELPAFLRSYQRAFNEFLERGKQLTNYRANVIANINNCLSFRMSMEQNWQVPQDTLSLLLGPLGELKSHGFDTLLQNLHEDLKPLFKRFTHTRWAAPVETLENIIATVDTRLPEFSELQGCFREELMEALHLHLVKEYIIQLSKGRLVLKTAEQQQQLAGYILANADTIQHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRIRSILDVSMGAQEPSRPLFSLIKVG