You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TGFBR3
Transforming growth factor beta receptor type 3

Protein Summary
Description
Binds to TGF-beta. Could be involved in capturing and retaining TGF-beta for presentation to the signaling receptors. This locus encodes the transforming growth factor (TGF)-beta type III receptor. The encoded receptor is a membrane proteoglycan that often functions as a co-receptor with other TGF-beta receptor superfamily members. Ectodomain shedding produces soluble TGFBR3, which may inhibit TGFB signaling. Decreased expression of this receptor has been observed in various cancers. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.[provided by RefSeq, Sep 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000212355
  • ENSP00000212355
  • ENSG00000069702
  • ENST00000370399
  • ENSP00000359426
  • ENST00000465892
  • ENSP00000432638
  • ENST00000525962
  • ENSP00000436127

Symbol
  • BGCAN
  • betaglycan
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
1
molecular function
0.99
biological process
0.98
disease
0.87
gene perturbation
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 102.37   (req: < 5)
Gene RIFs: 90   (req: <= 3)
Antibodies: 407   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 102.37   (req: >= 5)
Gene RIFs: 90   (req: > 3)
Antibodies: 407   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 47
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (56)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Mutant Phenotype (IMP)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (93)
1 – 10 of 93
HADHA
Tbio
Novelty: 0.00234785
p_int: 0.999997483
p_ni: 0.000002517
Data Source: BioPlex
GPR183
Tchem
Family: GPCR
Novelty: 0.021257
p_int: 0.999883983
p_ni: 0.000116017
Data Source: BioPlex
CAMKV
Tbio
Family: Kinase
Novelty: 0.02297481
p_int: 0.999550516
p_ni: 0.000449481
p_wrong: 3e-9
Data Source: BioPlex
FGF1
Tchem
Novelty: 0.00060955
p_int: 0.99907326
p_ni: 0.000926737
p_wrong: 4e-9
Score: 0.26
Data Source: BioPlex,STRINGDB
DEFA5
Tbio
Novelty: 0.01045537
p_int: 0.999013995
p_ni: 0.000986004
p_wrong: 1e-9
Data Source: BioPlex
ATP1B4
Tdark
Family: Transporter
Novelty: 0.01060988
p_int: 0.998818045
p_ni: 0.00118194
p_wrong: 1.5e-8
Data Source: BioPlex
KLK11
Tbio
Family: Enzyme
Novelty: 0.00344545
p_int: 0.998425026
p_ni: 0.001574241
p_wrong: 7.32e-7
Data Source: BioPlex
ST8SIA4
Tbio
Family: Enzyme
Novelty: 0.00575428
p_int: 0.998194983
p_ni: 0.001796844
p_wrong: 0.000008173
Data Source: BioPlex
FAM19A4
Tbio
Novelty: 0.04762169
p_int: 0.998178056
p_ni: 0.001818687
p_wrong: 0.000003257
Data Source: BioPlex
LRRTM4
Tbio
Novelty: 0.17645205
p_int: 0.998138098
p_ni: 0.001861897
p_wrong: 5e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  102.37

PubMed score by year
PubTator Score  110.37

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTSHYVIAIFALMSSCLATAGPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGLPQEVHVLNLR
1-70
TAGQGPGQLQREVTLHLNPISSVHIHHKSVVFLLNSPHPLVWHLKTERLATGVSRLFLVSEGSVVQFSSA
70-140
NFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLA
140-210
EYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVN
210-280
WVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANR
280-350
FHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDG
350-420
LPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVTLLDPTCKAK
420-490
MNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDAS
490-560
LFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQ
560-630
ELGFAIQTCFISPYSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSL
630-700
LFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKE
700-770
PNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGST
770-840
QSTPCSSSSTA
840-851
MTSHYVIAIFALMSSCLATAGPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGLPQEVHVLNLRTAGQGPGQLQREVTLHLNPISSVHIHHKSVVFLLNSPHPLVWHLKTERLATGVSRLFLVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGSTQSTPCSSSSTA