You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GNA12
Guanine nucleotide-binding protein subunit alpha-12

Protein Summary
Description
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (PubMed:22609986, PubMed:15525651, PubMed:15240885, PubMed:17565996, PubMed:12515866, PubMed:16787920, PubMed:16705036, PubMed:23762476, PubMed:27084452). Activates effector molecule RhoA by binding and activating RhoGEFs (ARHGEF12/LARG) (PubMed:15240885, PubMed:12515866, PubMed:16202387). GNA12-dependent Rho signaling subsequently regulates transcription factor AP-1 (activating protein-1) (By similarity). GNA12-dependent Rho signaling also regulates protein phosphatese 2A activation causing dephosphorylation of its target proteins (PubMed:15525651, PubMed:17565996). Promotes tumor cell invasion and metastasis by activating RhoA/ROCK signaling pathway and up-regulating proinflammatory cytokine production (PubMed:23762476, PubMed:16787920, PubMed:16705036, PubMed:27084452). Inhibits CDH1-mediated cell adhesion in process independent from Rho activation (P ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000275364
  • ENSP00000275364
  • ENSG00000146535
  • ENST00000407904
  • ENSP00000385935

Symbol
  • RMP
  • gep
  • NNX3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.99
kinase perturbation
0.97
transcription factor perturbation
0.88
trait
0.86
transcription factor binding site profile
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.95   (req: < 5)
Gene RIFs: 52   (req: <= 3)
Antibodies: 210   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.95   (req: >= 5)
Gene RIFs: 52   (req: > 3)
Antibodies: 210   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (37)
G alpha (12/13) signalling events (R-HSA-416482)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
G alpha (12/13) signalling events
Reactome
GPCR downstream signalling
Reactome
Hemostasis
Reactome
Platelet activation, signaling and aggregation
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
G alpha (12/13) signalling events
GPCR downstream signalling
Hemostasis
Platelet activation, signaling and aggregation
Signal Transduction
Gene Ontology Terms (25)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (164)
1 – 10 of 164
GNA13
Tbio
Novelty: 0.05970556
p_int: 0.975035667
p_ni: 0.024964333
Score: 0.937
Data Source: BioPlex,STRINGDB
GNAS
Tbio
Novelty: 0.00259764
p_int: 0.974796247
p_ni: 0.025203753
Score: 0.74
Data Source: BioPlex,STRINGDB
GNG2
Tbio
Novelty: 0.08273543
p_int: 0.940376401
p_ni: 0.059623599
Score: 0.943
Data Source: BioPlex,Reactome,STRINGDB
GNGT1
Tbio
Novelty: 0.03653174
p_int: 0.907228962
p_ni: 0.092771038
Score: 0.953
Data Source: BioPlex,STRINGDB
RIC8A
Tbio
Novelty: 0.01968858
p_int: 0.781300617
p_ni: 0.218699383
Score: 0.349
Data Source: BioPlex,STRINGDB
ARHGEF12
Tbio
Novelty: 0.00213883
Score: 0.989
Data Source: Reactome,STRINGDB
GNB1
Tbio
Novelty: 0.04716243
Score: 0.975
Data Source: Reactome,STRINGDB
GNB3
Tbio
Novelty: 0.0043523
Score: 0.967
Data Source: STRINGDB
GNG12
Tbio
Novelty: 0.19029707
Score: 0.959
Data Source: STRINGDB
GNB4
Tbio
Novelty: 0.1530232
Score: 0.958
Data Source: STRINGDB
Publication Statistics
PubMed Score  9.95

PubMed score by year
PubTator Score  72.24

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKILLLGAGESGK
1-70
STFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGL
70-140
PVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKG
140-210
IVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETI
210-280
VNNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHF
280-350
TTAIDTENVRFVFHAVKDTILQENLKDIMLQ
350-381
MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLKDIMLQ