You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
POU3F1
POU domain, class 3, transcription factor 1

Protein Summary
Description
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Thought to be involved in early embryogenesis and neurogenesis.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373012
  • ENSP00000362103
  • ENSG00000185668

Symbol
  • OCT6
  • OTF6
  • OCT6
  • OTF6
  • SCIP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
transcription factor
0.72
PubMedID
0.7
tissue sample
0.68
transcription factor binding site profile
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 212.16   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 242   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 212.16   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 242   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (57)
1 – 10 of 57
EGR2
Tbio
Family: TF
Novelty: 0.00267713
Score: 0.813
Data Source: STRINGDB
NPAS1
Tbio
Family: TF
Novelty: 0.13050909
Score: 0.755
Data Source: STRINGDB
SOX10
Tbio
Family: TF
Novelty: 0.0013153
Score: 0.75
Data Source: STRINGDB
SOX2
Tbio
Family: TF
Novelty: 0.00050367
Score: 0.731
Data Source: STRINGDB
NPAS3
Tbio
Family: TF
Novelty: 0.03059697
Score: 0.697
Data Source: STRINGDB
SOX12
Tbio
Family: TF
Novelty: 0.0754941
Score: 0.685
Data Source: STRINGDB
HOXA5
Tbio
Family: TF
Novelty: 0.00768782
Score: 0.653
Data Source: STRINGDB
CCDC6
Tbio
Novelty: 0.01216915
Score: 0.633
Data Source: STRINGDB
SOX3
Tbio
Family: TF
Novelty: 0.00443141
Score: 0.63
Data Source: STRINGDB
MPZ
Tbio
Novelty: 0.00266157
Score: 0.625
Data Source: STRINGDB
Publication Statistics
PubMed Score  212.16

PubMed score by year
PubTator Score  156.2

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAH
1-70
PQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGSTAHHLGPA
70-140
MSPSPGASGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGA
140-210
HGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLAL
210-280
GTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGV
280-350
KGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPG
350-420
GGGASPPSAPPPPPPAALHHHHHHTLPGSVQ
420-451
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGSTAHHLGPAMSPSPGASGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPGGGGASPPSAPPPPPPAALHHHHHHTLPGSVQ