You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CYP27A1
Sterol 26-hydroxylase, mitochondrial

Protein Summary
Description
Catalyzes the first step in the oxidation of the side chain of sterol intermediates; the 27-hydroxylation of 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol. Has also a vitamin D3-25-hydroxylase activity. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000258415
  • ENSP00000258415
  • ENSG00000135929

Symbol
  • CYP27
  • CTX
  • CP27
  • CYP27
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.95
gene perturbation
0.8
molecular function
0.73
virus perturbation
0.72
disease
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1040.41   (req: < 5)
Gene RIFs: 68   (req: <= 3)
Antibodies: 233   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1040.41   (req: >= 5)
Gene RIFs: 68   (req: > 3)
Antibodies: 233   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (27)
Bile acid and bile salt metabolism (R-HSA-194068)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Bile acid and bile salt metabolism
Reactome
Biological oxidations
Reactome
Cytochrome P450 - arranged by substrate type
Reactome
Defective CYP27A1 causes Cerebrotendinous xanthomatosis (CTX)
Reactome
Disease
Name
Explore in Pharos
Explore in Source
Bile acid and bile salt metabolism
Biological oxidations
Cytochrome P450 - arranged by substrate type
Defective CYP27A1 causes Cerebrotendinous xanthomatosis (CTX)
Disease
Protein-Protein Interactions (97)
1 – 10 of 97
CYP7A1
Tbio
Family: Enzyme
Novelty: 0.00194919
Score: 0.987
Data Source: STRINGDB
CH25H
Tbio
Family: Enzyme
Novelty: 0.02064686
Score: 0.958
Data Source: STRINGDB
CYP46A1
Tbio
Family: Enzyme
Novelty: 0.01440181
Score: 0.941
Data Source: STRINGDB
CYP7B1
Tbio
Family: Enzyme
Novelty: 0.01860356
Score: 0.94
Data Source: STRINGDB
SLC27A5
Tbio
Family: Transporter
Novelty: 0.00055254
Score: 0.939
Data Source: STRINGDB
DHCR7
Tchem
Family: Enzyme
Novelty: 0.00335133
Score: 0.921
Data Source: STRINGDB
AKR1C4
Tchem
Family: Enzyme
Novelty: 0.01254897
Score: 0.914
Data Source: STRINGDB
FASN
Tchem
Family: Enzyme
Novelty: 0.00201045
Score: 0.892
Data Source: STRINGDB
LIPA
Tchem
Family: Enzyme
Novelty: 0.00113603
Score: 0.869
Data Source: STRINGDB
CCT3
Tbio
Novelty: 0.00555442
Score: 0.868
Data Source: STRINGDB
Publication Statistics
PubMed Score  1040.41

PubMed score by year
PubTator Score  884.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFF
1-70
QLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQH
70-140
DLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFY
140-210
YFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFS
210-280
FGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYH
280-350
LSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPK
350-420
NTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLL
420-490
ARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
490-531
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC