You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
COX6A2
Cytochrome c oxidase subunit 6A2, mitochondrial

Protein Summary
Description
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000287490
  • ENSP00000287490
  • ENSG00000156885

Symbol
  • COX6A
  • COX6AH
  • COX6AH
  • COXVIAH
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
disease perturbation
0.74
small molecule perturbation
0.69
cellular component
0.68
molecular function
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.96   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 98   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.96   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 98   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (10)
Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Non-alcoholic fatty liver disease (NAFLD)
KEGG
Alzheimer disease
KEGG
Huntington disease
KEGG
Thermogenesis
KEGG
Cardiac muscle contraction
Name
Explore in Pharos
Explore in Source
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer disease
Huntington disease
Thermogenesis
Cardiac muscle contraction
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (160)
1 – 10 of 160
COX5A
Tbio
Family: Enzyme
Novelty: 0.00062551
Score: 0.997
Data Source: STRINGDB
COX5B
Tbio
Family: Enzyme
Novelty: 0.02465452
Score: 0.996
Data Source: STRINGDB
COX6C
Tbio
Family: Enzyme
Novelty: 0.05809639
Score: 0.995
Data Source: STRINGDB
UQCRQ
Tbio
Novelty: 0.06872273
Score: 0.993
Data Source: STRINGDB
COX6B1
Tbio
Family: Enzyme
Novelty: 0.03940517
Score: 0.987
Data Source: STRINGDB
COX4I2
Tbio
Family: Enzyme
Novelty: 0.02023201
Score: 0.985
Data Source: STRINGDB
COX7C
Tbio
Family: Enzyme
Novelty: 0.09213557
Score: 0.985
Data Source: STRINGDB
UQCR10
Tbio
Novelty: 0.06417301
Score: 0.983
Data Source: STRINGDB
COX6B2
Tdark
Family: Enzyme
Novelty: 0.18870622
Score: 0.983
Data Source: STRINGDB
COX4I1
Tbio
Family: Enzyme
Novelty: 0.00416656
Score: 0.982
Data Source: STRINGDB
Publication Statistics
PubMed Score  10.96

PubMed score by year
PubTator Score  4.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTK
1-70
PYPWGDGNHTLFHNSHVNPLPTGYEHP
70-97
MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP