You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
NAAA
N-acylethanolamine-hydrolyzing acid amidase

Protein Summary
Description
Degrades bioactive fatty acid amides to their corresponding acids, with the following preference: N-palmitoylethanolamine > N-myristoylethanolamine > N-lauroylethanolamine = N-stearoylethanolamine > N-arachidonoylethanolamine > N-oleoylethanolamine. Also exhibits weak hydrolytic activity against the ceramides N-lauroylsphingosine and N-palmitoylsphingosine. This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000286733
  • ENSP00000286733
  • ENSG00000138744
  • ENST00000507956
  • ENSP00000427641

Symbol
  • ASAHL
  • PLT
  • PLT
  • ASAHL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.8
interacting protein
0.7
cellular component
0.68
tissue sample
0.68
disease
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 495.17   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 179   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 495.17   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 179   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 49
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Neuronal System (R-HSA-112316)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Neuronal System
Reactome
Neurotransmitter release cycle
Reactome
Transmission across Chemical Synapses
Name
Explore in Pharos
Explore in Source
Neuronal System
Neurotransmitter release cycle
Transmission across Chemical Synapses
Protein-Protein Interactions (74)
1 – 10 of 74
SIAE
Tbio
Family: Enzyme
Novelty: 0.00505798
p_int: 0.999669874
p_ni: 0.000330126
Score: 0.75
Data Source: BioPlex,STRINGDB
RLN1
Tbio
Novelty: 0.05712331
p_int: 0.99941834
p_ni: 0.000179682
p_wrong: 0.000401978
Data Source: BioPlex
MAN2B2
Tbio
Family: Enzyme
Novelty: 0.19420332
p_int: 0.998229583
p_ni: 0.001758804
p_wrong: 0.000011613
Score: 0.61
Data Source: BioPlex,STRINGDB
EDEM1
Tbio
Family: Enzyme
Novelty: 0.01709827
p_int: 0.99704788
p_ni: 0.002951447
p_wrong: 6.73e-7
Data Source: BioPlex
ARSB
Tbio
Family: Enzyme
Novelty: 0.00299621
p_int: 0.994824816
p_ni: 0.005006623
p_wrong: 0.000168561
Score: 0.271
Data Source: BioPlex,STRINGDB
NDST1
Tbio
Family: Enzyme
Novelty: 0.01114446
p_int: 0.993577179
p_ni: 0.005757433
p_wrong: 0.000665388
Score: 0.181
Data Source: BioPlex,STRINGDB
ARSK
Tbio
Family: Enzyme
Novelty: 0.05937509
p_int: 0.990752457
p_ni: 0.00924754
p_wrong: 3e-9
Data Source: BioPlex
OAF
Tbio
Novelty: 0.01386917
p_int: 0.987626863
p_ni: 0.012373137
Data Source: BioPlex
CEMIP2
Tbio
Novelty: 0.0935128
p_int: 0.987120486
p_ni: 0.012871676
p_wrong: 0.000007838
Score: 0.527
Data Source: BioPlex,STRINGDB
FUT11
Tdark
Family: Enzyme
Novelty: 0.54098361
p_int: 0.986416778
p_ni: 0.013583077
p_wrong: 1.45e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  495.17

PubMed score by year
PubTator Score  77.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRTADREARPGLPSLLLLLLAGAGLSAASPPAAPRFNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGD
1-70
RVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCDFMNLSLADCLLVNLAYESSVFCTSIVAQDSRGHIYH
70-140
GRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDKGWWWENAIAALF
140-210
RRHIPVSWLIRATLSESENFEAAVGKLAKTPLIADVYYIVGGTSPREGVVITRNRDGPADIWPLDPLNGA
210-280
WFRVETNYDHWKPAPKEDDRRTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGSPDKYM
280-350
TRIRNPSRK
350-359
MRTADREARPGLPSLLLLLLAGAGLSAASPPAAPRFNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCDFMNLSLADCLLVNLAYESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDKGWWWENAIAALFRRHIPVSWLIRATLSESENFEAAVGKLAKTPLIADVYYIVGGTSPREGVVITRNRDGPADIWPLDPLNGAWFRVETNYDHWKPAPKEDDRRTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGSPDKYMTRIRNPSRK