You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
AMPD2
AMP deaminase 2

Protein Summary
Description
AMP deaminase plays a critical role in energy metabolism. Catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle. The protein encoded by this gene is important in purine metabolism by converting AMP to IMP. The encoded protein, which acts as a homotetramer, is one of three AMP deaminases found in mammals. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000256578
  • ENSP00000256578
  • ENSG00000116337
  • ENST00000342115
  • ENSP00000345498
  • ENST00000358729
  • ENSP00000351573
  • ENST00000393688
  • ENSP00000377292
  • ENST00000528454
  • ENSP00000437164
  • ENST00000528667
  • ENSP00000436541

Symbol
  • PCH9
  • SPG63
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.83
transcription factor
0.8
transcription factor perturbation
0.74
kinase perturbation
0.66
virus perturbation
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 55.59   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 195   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 55.59   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 195   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 7
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of nucleotides
Reactome
Nucleotide salvage
Reactome
Purine salvage
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of nucleotides
Nucleotide salvage
Purine salvage
Gene Ontology Terms (8)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Genetic Interaction (IGI)
MGI
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (108)
1 – 10 of 108
PAGE1
Tbio
Novelty: 0.03291446
p_int: 0.999999939
p_ni: 6.1e-8
Data Source: BioPlex
AMPD3
Tchem
Family: Enzyme
Novelty: 0.01389213
p_int: 0.999999585
p_ni: 4.15e-7
Score: 0.809
Data Source: BioPlex,STRINGDB
EPS8
Tbio
Family: Enzyme
Novelty: 0.01212061
p_int: 0.999994244
p_ni: 0.00000571
p_wrong: 4.6e-8
Score: 0.193
Data Source: BioPlex,STRINGDB
CD44
Tbio
Novelty: 0.00013754
p_int: 0.999955489
p_ni: 0.000044508
p_wrong: 3e-9
Data Source: BioPlex
GPBP1L1
Tdark
Novelty: 0.23809524
p_int: 0.999926344
p_ni: 0.000073655
p_wrong: 1e-9
Data Source: BioPlex
EIF1AD
Tdark
Novelty: 0.26086957
p_int: 0.999813615
p_ni: 0.000186385
Data Source: BioPlex
DCAF8
Tbio
Novelty: 0.27272727
p_int: 0.99976518
p_ni: 0.000234811
p_wrong: 1e-8
Data Source: BioPlex
IL7R
Tbio
Novelty: 0.00182378
p_int: 0.999681947
p_ni: 0.000318053
Data Source: BioPlex
SDC2
Tbio
Novelty: 0.00780417
p_int: 0.999373513
p_ni: 0.000626486
p_wrong: 1e-9
Data Source: BioPlex
LZTS2
Tbio
Novelty: 0.12012012
p_int: 0.998601377
p_ni: 0.001398617
p_wrong: 6e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  55.59

PubMed score by year
PubTator Score  25.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRNRGQGLFRLRSRCFLHQSLPLGAGRRKGLDVAEPGPSRCRSDSPAVAAVVPAMASYPSGSGKPKAKYP
1-70
FKKRASLQASTAAPEARGGLGAPPLQSARSLPGPAPCLKHFPLDLRTSMDGKCKEIAEELFTRSLAESEL
70-140
RSAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLR
140-210
ERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLET
210-280
RTYEQGPDTPVSADAPVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDEHCSEVELPYP
280-350
DLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIH
350-420
ASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKF
420-490
NAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVM
490-560
HRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDE
560-630
SKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSA
630-700
FMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFH
700-770
FTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRV
770-840
GYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ
840-879
MRNRGQGLFRLRSRCFLHQSLPLGAGRRKGLDVAEPGPSRCRSDSPAVAAVVPAMASYPSGSGKPKAKYPFKKRASLQASTAAPEARGGLGAPPLQSARSLPGPAPCLKHFPLDLRTSMDGKCKEIAEELFTRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAPVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDEHCSEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ