You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MS4A2
High affinity immunoglobulin epsilon receptor subunit beta

Protein Classes
Protein Summary
Description
High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. Also mediates the secretion of important lymphokines. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators responsible for the manifestations of allergy. The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000278888
  • ENSP00000278888
  • ENSG00000149534

Symbol
  • APY
  • FCER1B
  • IGER
  • APY
  • IGEL
  • IGER
  • ATOPY
  • FCERI
  • IGHER
  • MS4A1
  • FCER1B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.73
molecular function
0.7
disease
0.67
hub protein
0.58
cell line
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1183.68   (req: < 5)
Gene RIFs: 39   (req: <= 3)
Antibodies: 68   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1183.68   (req: >= 5)
Gene RIFs: 39   (req: > 3)
Antibodies: 68   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (8)
Fc epsilon receptor (FCERI) signaling (R-HSA-2454202)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Fc epsilon receptor (FCERI) signaling
Reactome
Immune System
Reactome
Innate Immune System
Name
Explore in Pharos
Explore in Source
Fc epsilon receptor (FCERI) signaling
Immune System
Innate Immune System
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (88)
1 – 10 of 88
FCER1A
Tbio
Novelty: 0.0048976
Score: 0.975
Data Source: Reactome,STRINGDB
LYN
Tclin
Family: Kinase
Novelty: 0.00137519
Score: 0.96
Data Source: Reactome,STRINGDB
SYK
Tclin
Family: Kinase
Novelty: 0.00067612
Score: 0.954
Data Source: Reactome,STRINGDB
FCGR2B
Tbio
Novelty: 0.0014896
Score: 0.938
Data Source: STRINGDB
FCER1G
Tbio
Novelty: 0.00930179
Score: 0.937
Data Source: Reactome,STRINGDB
INPP5D
Tbio
Family: Enzyme
Novelty: 0.00819089
Score: 0.937
Data Source: STRINGDB
PTPN11
Tchem
Family: Enzyme
Novelty: 0.00086268
Score: 0.935
Data Source: STRINGDB
CBLB
Tbio
Family: Enzyme
Novelty: 0.1275465
Score: 0.935
Data Source: STRINGDB
GRB2
Tchem
Novelty: 0.00060543
Score: 0.935
Data Source: Reactome,STRINGDB
VAV1
Tchem
Novelty: 0.00223848
Score: 0.928
Data Source: STRINGDB
Publication Statistics
PubMed Score  1183.68

PubMed score by year
PubTator Score  73.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAM
1-70
ICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIA
70-140
GGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKG
140-210
NKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL
210-244
MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL