You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CYCS
Cytochrome c

Protein Classes
Protein Summary
Description
Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases. This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. Th ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000305786
  • ENSP00000307786
  • ENSG00000172115
  • ENST00000409409
  • ENSP00000386270
  • ENST00000409764
  • ENSP00000387279

Symbol
  • CYC
  • CYC
  • HCS
  • THC4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
1
transcription factor perturbation
1
co-expressed gene
0.95
histone modification site profile
0.89
interacting protein
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5034.51   (req: < 5)
Gene RIFs: 49   (req: <= 3)
Antibodies: 1260   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5034.51   (req: >= 5)
Gene RIFs: 49   (req: > 3)
Antibodies: 1260   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL353314
chemical structure image
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (113)
Activation of caspases through apoptosome-mediated cleavage (R-HSA-111459)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 27
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of caspases through apoptosome-mediated cleavage
Reactome
Apoptosis
Reactome
Apoptotic factor-mediated response
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Name
Explore in Pharos
Explore in Source
Activation of caspases through apoptosome-mediated cleavage
Apoptosis
Apoptotic factor-mediated response
Cellular responses to external stimuli
Cellular responses to stress
Protein-Protein Interactions (746)
1 – 10 of 746
LRG1
Tbio
Novelty: 0.00703305
p_int: 0.998752099
p_ni: 0.001247901
Score: 0.862
Data Source: BioPlex,STRINGDB
COX5B
Tbio
Family: Enzyme
Novelty: 0.02465452
Score: 0.999
Data Source: STRINGDB
CYC1
Tbio
Novelty: 0.01978836
Score: 0.999
Data Source: STRINGDB
MT-CO1
Tchem
Family: Enzyme
Novelty: 0.00015408
Score: 0.999
Data Source: STRINGDB
UQCRFS1
Tbio
Novelty: 0.00380742
Score: 0.999
Data Source: STRINGDB
CASP9
Tchem
Family: Enzyme
Novelty: 0.00031573
Score: 0.998
Data Source: Reactome,STRINGDB
UQCRB
Tbio
Novelty: 0.04413786
Score: 0.998
Data Source: STRINGDB
COX4I1
Tbio
Family: Enzyme
Novelty: 0.00416656
Score: 0.998
Data Source: STRINGDB
APAF1
Tbio
Family: Enzyme
Novelty: 0.00164778
Score: 0.998
Data Source: Reactome,STRINGDB
MT-CYB
Tbio
Novelty: 0.00015981
Score: 0.998
Data Source: STRINGDB
Publication Statistics
PubMed Score  5034.51

PubMed score by year
PubTator Score  9999.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLE
1-70
NPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
70-105
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE