You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CBX1
Chromobox protein homolog 1

Protein Summary
Description
Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane. This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [p ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000225603
  • ENSP00000225603
  • ENSG00000108468
  • ENST00000393408
  • ENSP00000377060

Symbol
  • CBX
  • CBX
  • M31
  • MOD1
  • p25beta
  • HP1-BETA
  • HP1Hsbeta
  • HP1Hs-beta
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.95
virus perturbation
0.94
disease perturbation
0.93
protein domain
0.85
ligand (protein) perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 205.49   (req: < 5)
Gene RIFs: 29   (req: <= 3)
Antibodies: 318   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 205.49   (req: >= 5)
Gene RIFs: 29   (req: > 3)
Antibodies: 318   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
The effect of progerin on the involved genes in Hutchinson-Gilford Progeria Syndrome
WikiPathways
The effect of progerin on the involved genes in Hutchinson-Gilford Progeria Syndrome
WikiPathways
The effect of progerin on the involved genes in Hutchinson-Gilford Progeria Syndrome
WikiPathways
The effect of progerin on the involved genes in Hutchinson-Gilford Progeria Syndrome
WikiPathways
The effect of progerin on the involved genes in Hutchinson-Gilford Progeria Syndrome
Name
Explore in Pharos
Explore in Source
The effect of progerin on the involved genes in Hutchinson-Gilford Progeria Syndrome
The effect of progerin on the involved genes in Hutchinson-Gilford Progeria Syndrome
The effect of progerin on the involved genes in Hutchinson-Gilford Progeria Syndrome
The effect of progerin on the involved genes in Hutchinson-Gilford Progeria Syndrome
The effect of progerin on the involved genes in Hutchinson-Gilford Progeria Syndrome
Protein-Protein Interactions (166)
1 – 10 of 166
PCGF6
Tbio
Novelty: 0.132061
p_int: 0.984463174
p_ni: 0.015536826
Score: 0.499
Data Source: BioPlex,STRINGDB
TRIM28
Tbio
Family: Epigenetic
Novelty: 0.01042773
p_int: 0.865646986
p_ni: 0.134353014
Score: 0.79
Data Source: BioPlex,STRINGDB
PRR14
Tbio
Novelty: 0.16853933
p_int: 0.857442931
p_ni: 0.142557068
p_wrong: 2e-9
Score: 0.198
Data Source: BioPlex,STRINGDB
SUV39H2
Tbio
Family: Epigenetic
Novelty: 0.03513137
p_int: 0.785512238
p_ni: 0.214487756
p_wrong: 6e-9
Score: 0.719
Data Source: BioPlex,STRINGDB
SUV39H1
Tchem
Family: Epigenetic
Novelty: 0.00504871
Score: 0.858
Data Source: STRINGDB
H3F3A
Tbio
Novelty: 0.00644912
Score: 0.856
Data Source: STRINGDB
HIST2H3A
Tbio
Novelty: 0.04593632
Score: 0.822
Data Source: STRINGDB
HIST3H3
Tbio
Novelty: 0.09996887
Score: 0.807
Data Source: STRINGDB
HIST1H3A
Tbio
Novelty: 0.01912636
Score: 0.764
Data Source: STRINGDB
SGO1
Tbio
Novelty: 0.00311495
Score: 0.762
Data Source: STRINGDB
Publication Statistics
PubMed Score  205.49

PubMed score by year
PubTator Score  128.86

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQS
1-70
QKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKN
70-140
SDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN
140-185
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN