You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IFI35
Interferon-induced 35 kDa protein

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.8   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 289   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.8   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 289   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (17)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interferon Signaling
Reactome
Interferon alpha/beta signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interferon Signaling
Interferon alpha/beta signaling
Gene Ontology Terms (3)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (169)
1 – 10 of 169
NMI
Tbio
Novelty: 0.0657104
p_int: 0.999999134
p_wrong: 8.66e-7
Score: 0.985
Data Source: BioPlex,STRINGDB
PLXNA1
Tbio
Novelty: 0.01144396
p_int: 0.980820112
p_ni: 0.019179888
Data Source: BioPlex
NFRKB
Tbio
Novelty: 0.16363636
p_int: 0.92760348
p_ni: 0.07239652
Data Source: BioPlex
CYTH3
Tbio
Novelty: 0.01440236
p_int: 0.895699573
p_ni: 0.104300426
p_wrong: 1e-9
Score: 0.211
Data Source: BioPlex,STRINGDB
IRF7
Tbio
Family: TF
Novelty: 0.00308898
Score: 0.992
Data Source: STRINGDB
IFIT3
Tbio
Novelty: 0.00899003
Score: 0.992
Data Source: STRINGDB
ISG15
Tbio
Novelty: 0.00256125
Score: 0.99
Data Source: STRINGDB
OAS1
Tbio
Family: Enzyme
Novelty: 0.00774033
Score: 0.99
Data Source: STRINGDB
MX1
Tbio
Novelty: 0.00081841
Score: 0.989
Data Source: STRINGDB
OAS3
Tbio
Family: Enzyme
Novelty: 0.04260345
Score: 0.989
Data Source: STRINGDB
Publication Statistics
PubMed Score  18.80

PubMed score by year
PubTator Score  14.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNL
1-70
RIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGF
70-140
PASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLR
140-210
VSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAV
210-280
FTSESG
280-286
MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG