You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
OLR1
Oxidized low-density lipoprotein receptor 1

Protein Summary
Description
Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for ad ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309539
  • ENSP00000309124
  • ENSG00000173391
  • ENST00000432556
  • ENSP00000405116
  • ENST00000545927
  • ENSP00000439251

Symbol
  • CLEC8A
  • LOX1
  • LOX1
  • LOXIN
  • SLOX1
  • CLEC8A
  • SCARE1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.98
biological term
0.96
disease
0.75
tissue
0.64
cellular component
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 802.47   (req: < 5)
Gene RIFs: 227   (req: <= 3)
Antibodies: 618   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 802.47   (req: >= 5)
Gene RIFs: 227   (req: > 3)
Antibodies: 618   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Cell surface interactions at the vascular wall (R-HSA-202733)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell surface interactions at the vascular wall
Reactome
Hemostasis
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Neutrophil degranulation
Name
Explore in Pharos
Explore in Source
Cell surface interactions at the vascular wall
Hemostasis
Immune System
Innate Immune System
Neutrophil degranulation
Gene Ontology Terms (18)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (180)
1 – 10 of 180
F5
Tbio
Novelty: 0.00193441
p_int: 0.999992129
p_ni: 0.00000787
p_wrong: 1e-9
Score: 0.685
Data Source: BioPlex,STRINGDB
APOB
Tchem
Novelty: 0.00010107
Score: 0.952
Data Source: STRINGDB
CYBB
Tchem
Family: IC
Novelty: 0.00068038
Score: 0.948
Data Source: STRINGDB
CYBA
Tbio
Novelty: 0.00230579
Score: 0.938
Data Source: STRINGDB
CD36
Tbio
Novelty: 0.00216049
Score: 0.936
Data Source: STRINGDB
ITGAX
Tbio
Novelty: 0.00064197
Score: 0.929
Data Source: STRINGDB
HSPA4
Tbio
Novelty: 0.00010789
Score: 0.927
Data Source: STRINGDB
ITGAM
Tbio
Novelty: 0.0002405
Score: 0.925
Data Source: STRINGDB
CLEC5A
Tbio
Novelty: 0.0230333
Score: 0.923
Data Source: STRINGDB
FPR2
Tchem
Family: GPCR
Novelty: 0.00286277
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  802.47

PubMed score by year
PubTator Score  538.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE
1-70
QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC
70-140
SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN
140-210
PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
210-273
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ