You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SRPK2
SRSF protein kinase 2

Protein Summary
Description
Serine/arginine-rich protein-specific kinase which specifically phosphorylates its substrates at serine residues located in regions rich in arginine/serine dipeptides, known as RS domains and is involved in the phosphorylation of SR splicing factors and the regulation of splicing. Promotes neuronal apoptosis by up-regulating cyclin-D1 (CCND1) expression. This is done by the phosphorylation of SRSF2, leading to the suppression of p53/TP53 phosphorylation thereby relieving the repressive effect of p53/TP53 on cyclin-D1 (CCND1) expression. Phosphorylates ACIN1, and redistributes it from the nuclear speckles to the nucleoplasm, resulting in cyclin A1 but not cyclin A2 up-regulation. Plays an essential role in spliceosomal B complex formation via the phosphorylation of DDX23/PRP28. Can mediate hepatitis B virus (HBV) core protein phosphorylation. Plays a negative role in the regulation of HBV replication through a mechanism not involving the phosphorylation of the core protein but by reduci ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000357311
  • ENSP00000349863
  • ENSG00000135250
  • ENST00000393651
  • ENSP00000377262
  • ENST00000489828
  • ENSP00000419791

Symbol
  • SFRSK2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
molecular function
0.98
transcription factor perturbation
0.88
kinase perturbation
0.84
transcription factor
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 116.6   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 143   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 116.6   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 143   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL1908397
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (213)
1 – 10 of 213
U2AF1
Tbio
Novelty: 0.02418525
p_int: 0.999632666
p_ni: 0.000367334
Score: 0.588
Data Source: BioPlex,STRINGDB
U2AF2
Tbio
Novelty: 0.00739606
p_int: 0.998950517
p_ni: 0.001049483
Score: 0.789
Data Source: BioPlex,STRINGDB
LUC7L
Tbio
Novelty: 0.08359873
p_int: 0.995332907
p_ni: 0.004667093
Score: 0.704
Data Source: BioPlex,STRINGDB
LUC7L2
Tdark
Novelty: 0.46134191
p_int: 0.980365462
p_ni: 0.019634538
Score: 0.221
Data Source: BioPlex,STRINGDB
PUF60
Tbio
Novelty: 0.0330882
p_int: 0.949860248
p_ni: 0.050139752
Data Source: BioPlex
SNRNP70
Tbio
Novelty: 0.00199593
p_int: 0.812684533
p_ni: 0.187315467
Score: 0.8
Data Source: BioPlex,STRINGDB
ZRSR2
Tbio
Novelty: 0.0875897
p_int: 0.762414726
p_ni: 0.237585274
Score: 0.53
Data Source: BioPlex,STRINGDB
DDX23
Tbio
Family: Enzyme
Novelty: 0.04727436
Score: 0.942
Data Source: STRINGDB
SRSF1
Tbio
Novelty: 0.00119334
Score: 0.936
Data Source: STRINGDB
SRSF2
Tbio
Novelty: 0.00273135
Score: 0.853
Data Source: STRINGDB
Publication Statistics
PubMed Score  116.60

PubMed score by year
PubTator Score  20.39

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGYHP
1-70
VKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDP
70-140
NKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKI
140-210
IHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQA
210-280
ELLEKRLQEIEELEREAERKIIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEE
280-350
KEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPN
350-420
AESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRS
420-490
RTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAG
490-560
YSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGEL
560-630
RHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS
630-688
MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIEELEREAERKIIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS