You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
DLG4
Disks large homolog 4

Protein Summary
Description
Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B. Also regulates AMPA-type glutamate receptor (AMPAR) immobilization at postsynaptic density keeping the channels in an activated state in the presence of glutamate and preventing synaptic depression. This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated s ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000302955
  • ENSP00000307471
  • ENSG00000132535
  • ENST00000399506
  • ENSP00000382425
  • ENST00000648172
  • ENSP00000497806

Symbol
  • PSD95
  • PSD95
  • SAP90
  • SAP-90
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
1
protein domain
0.99
biological process
0.96
molecular function
0.94
transcription factor binding site profile
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1146.29   (req: < 5)
Gene RIFs: 56   (req: <= 3)
Antibodies: 770   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1146.29   (req: >= 5)
Gene RIFs: 56   (req: > 3)
Antibodies: 770   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 37
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (15)
1 – 5 of 15
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (91)
Activation of Ca-permeable Kainate Receptor (R-HSA-451308)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 38
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of Ca-permeable Kainate Receptor
Reactome
Activation of NMDA receptors and postsynaptic events
Reactome
Activation of kainate receptors upon glutamate binding
Reactome
Assembly and cell surface presentation of NMDA receptors
Reactome
Axon guidance
Name
Explore in Pharos
Explore in Source
Activation of Ca-permeable Kainate Receptor
Activation of NMDA receptors and postsynaptic events
Activation of kainate receptors upon glutamate binding
Assembly and cell surface presentation of NMDA receptors
Axon guidance
Gene Ontology Terms (59)
Items per page:
10
1 – 10 of 13
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (473)
1 – 10 of 473
DLGAP1
Tbio
Novelty: 0.02426833
Score: 0.999
Data Source: Reactome,STRINGDB
GRIN2B
Tclin
Family: IC
Novelty: 0.00042857
Score: 0.997
Data Source: Reactome,STRINGDB
GRIN2A
Tclin
Family: IC
Novelty: 0.00075253
Score: 0.995
Data Source: Reactome,STRINGDB
GRIA1
Tclin
Family: IC
Novelty: 0.00063312
Score: 0.993
Data Source: STRINGDB
GRIN1
Tclin
Family: IC
Novelty: 0.00132693
Score: 0.993
Data Source: Reactome,STRINGDB
DLGAP4
Tbio
Novelty: 0.08799804
Score: 0.993
Data Source: Reactome,STRINGDB
LRFN1
Tdark
Novelty: 0.39585297
Score: 0.993
Data Source: Reactome,STRINGDB
LRFN2
Tbio
Novelty: 0.13401404
Score: 0.992
Data Source: Reactome,STRINGDB
NLGN1
Tbio
Family: Enzyme
Novelty: 0.01074328
Score: 0.992
Data Source: STRINGDB
GRIA2
Tclin
Family: IC
Novelty: 0.00187801
Score: 0.991
Data Source: STRINGDB
Publication Statistics
PubMed Score  1146.29

PubMed score by year
PubTator Score  663.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLER
1-70
GNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEA
70-140
GSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGD
140-210
KILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGT
210-280
DYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLS
280-350
GELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGT
350-420
ASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPS
420-490
KRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFG
490-560
SCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDV
560-630
SANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEI
630-700
YHKVKRVIEDLSGPYIWVPARERL
700-724
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL