You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CSNK2A1
Casein kinase II subunit alpha

Protein Summary
Description
Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activat ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000217244
  • ENSP00000217244
  • ENSG00000101266
  • ENST00000349736
  • ENSP00000339247
  • ENST00000400217
  • ENSP00000383076
  • ENST00000643660
  • ENSP00000495248
  • ENST00000644003
  • ENSP00000495387
  • ENST00000645623
  • ENSP00000495998
  • ENST00000646305
  • ENSP00000495902
  • ENST00000646477
  • ENSP00000495439
  • ENST00000646561
  • ENSP00000496569
  • ENST00000646814
  • ENSP00000495422
  • ENST00000647348
  • ENSP00000495912

Symbol
  • CK2A1
  • CKII
  • Cka1
  • Cka2
  • CK2A1
  • OCNDS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
hub protein
1
virus
1
viral protein
0.98
biological process
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 521.84   (req: < 5)
Gene RIFs: 264   (req: <= 3)
Antibodies: 682   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 521.84   (req: >= 5)
Gene RIFs: 264   (req: > 3)
Antibodies: 682   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 175
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (175)
1 – 10 of 175
CHEMBL1230165
chemical structure image
CHEMBL3699282
chemical structure image
CHEMBL3699257
chemical structure image
CHEMBL3699291
chemical structure image
CHEMBL1652697
chemical structure image
CHEMBL1682297
chemical structure image
CHEMBL3681207
chemical structure image
CHEMBL3681205
chemical structure image
CHEMBL3681202
chemical structure image
Protein Data Bank (147)
1 – 5 of 147
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (61)
Autophagy (R-HSA-9612973)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 39
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Autophagy
Reactome
Axon guidance
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
Cellular responses to external stimuli
Name
Explore in Pharos
Explore in Source
Autophagy
Axon guidance
Cell Cycle
Cell Cycle, Mitotic
Cellular responses to external stimuli
Gene Ontology Terms (31)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (397)
1 – 10 of 397
VSX1
Tbio
Family: TF
Novelty: 0.01335126
p_int: 0.999996742
p_ni: 0.000003258
Score: 0.547
Data Source: BioPlex,STRINGDB
HDGFL2
Tbio
Family: Epigenetic
Novelty: 0.12835229
p_int: 0.999996572
p_ni: 0.000003428
Score: 0.254
Data Source: BioPlex,STRINGDB
NKAP
Tbio
Novelty: 0.07223114
p_int: 0.999970625
p_ni: 0.000029375
Score: 0.444
Data Source: BioPlex,STRINGDB
CSNK2B
Tbio
Family: Kinase
Novelty: 0.00171173
p_int: 0.999964108
p_ni: 0.000035892
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
HEXIM2
Tbio
Novelty: 0.3030303
p_int: 0.999935436
p_ni: 0.000064564
Data Source: BioPlex
HIRIP3
Tdark
Novelty: 0.64900846
p_int: 0.999929523
p_ni: 0.000070477
Score: 0.379
Data Source: BioPlex,STRINGDB
NKAPD1
Tdark
Novelty: 2.25
p_int: 0.999911768
p_ni: 0.000088232
Score: 0.622
Data Source: BioPlex,STRINGDB
CSNK2A2
Tchem
Family: Kinase
Novelty: 0.00420757
p_int: 0.999904912
p_ni: 0.000095088
Score: 0.983
Data Source: BioPlex,Reactome,STRINGDB
RYBP
Tbio
Novelty: 0.01436012
p_int: 0.999756457
p_ni: 0.000243543
Score: 0.928
Data Source: BioPlex,STRINGDB
YAF2
Tbio
Novelty: 0.14775726
p_int: 0.999684267
p_ni: 0.000315733
Score: 0.921
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  521.84

PubMed score by year
PubTator Score  258.25

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL
1-70
KPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEI
70-140
LKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYD
140-210
YSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKR
210-280
WERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSAN
280-350
MMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
350-391
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ