You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TPM4
Tropomyosin alpha-4 chain

Protein Summary
Description
Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments (By similarity). Binds calcium (PubMed:1836432). This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Multiple transcript variants encoding different isoforms have been found for this ge ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000300933
  • ENSP00000300933
  • ENSG00000167460
  • ENST00000344824
  • ENSP00000345230
  • ENST00000643579
  • ENSP00000495347
  • ENST00000646974
  • ENSP00000494125

Symbol
  • HEL-S-108
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
PubMedID
0.92
transcription factor binding site profile
0.76
microRNA
0.74
tissue
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 141.9   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 153   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 141.9   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 153   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (8)
Muscle contraction (R-HSA-397014)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Muscle contraction
Reactome
Smooth Muscle Contraction
Reactome
Striated Muscle Contraction
Name
Explore in Pharos
Explore in Source
Muscle contraction
Smooth Muscle Contraction
Striated Muscle Contraction
Gene Ontology Terms (20)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (159)
1 – 10 of 159
TPM1
Tbio
Novelty: 0.00363188
p_int: 0.960545996
p_ni: 0.039454004
Score: 0.977
Data Source: BioPlex,STRINGDB
ACTG2
Tbio
Novelty: 0.00388853
Score: 0.986
Data Source: STRINGDB
ACTA2
Tbio
Novelty: 0.00281551
Score: 0.985
Data Source: STRINGDB
TNNC2
Tbio
Novelty: 0.11856592
Score: 0.976
Data Source: STRINGDB
ACTN2
Tbio
Novelty: 0.00993205
Score: 0.974
Data Source: STRINGDB
TPM2
Tbio
Novelty: 0.00510926
Score: 0.974
Data Source: STRINGDB
TNNI2
Tbio
Novelty: 0.04330206
Score: 0.971
Data Source: STRINGDB
TNNT3
Tbio
Novelty: 0.0268478
Score: 0.971
Data Source: STRINGDB
TNNT1
Tbio
Novelty: 0.00097799
Score: 0.969
Data Source: STRINGDB
TMOD3
Tbio
Novelty: 0.06428995
Score: 0.968
Data Source: STRINGDB
Publication Statistics
PubMed Score  141.90

PubMed score by year
PubTator Score  28.35

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERL
1-70
ATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGEL
70-140
ERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTV
140-210
AKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
210-248
MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI