You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
TNNC1
Troponin C, slow skeletal and cardiac muscles

Protein Summary
Description
Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments. Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. [provided by RefSeq, Oct 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000232975
  • ENSP00000232975
  • ENSG00000114854

Symbol
  • TNNC
  • TNC
  • TN-C
  • TNNC
  • CMD1Z
  • CMH13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.79
gene perturbation
0.7
PubMedID
0.69
molecular function
0.63
small molecule perturbation
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.14   (req: < 5)
Gene RIFs: 63   (req: <= 3)
Antibodies: 387   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.14   (req: >= 5)
Gene RIFs: 63   (req: > 3)
Antibodies: 387   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
levosimendan
chemical structure image
Protein Data Bank (37)
1 – 5 of 37
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (210)
Muscle contraction (R-HSA-397014)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Muscle contraction
Reactome
Striated Muscle Contraction
Name
Explore in Pharos
Explore in Source
Muscle contraction
Striated Muscle Contraction
Gene Ontology Terms (19)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (89)
1 – 10 of 89
MIDN
Tbio
Novelty: 0.06131834
p_int: 0.999999945
p_ni: 5.4e-8
p_wrong: 1e-9
Data Source: BioPlex
MYO3A
Tbio
Family: Kinase
Novelty: 0.04741023
p_int: 0.999999865
p_ni: 8.8e-8
p_wrong: 4.7e-8
Score: 0.273
Data Source: BioPlex,STRINGDB
MYO5B
Tbio
Novelty: 0.01767008
p_int: 0.999995094
p_ni: 0.000004906
p_wrong: 1e-9
Score: 0.305
Data Source: BioPlex,STRINGDB
ATP23
Tbio
Family: Enzyme
Novelty: 0.13977877
p_int: 0.999952537
p_ni: 0.000047369
p_wrong: 9.4e-8
Data Source: BioPlex
IQCD
Tdark
Novelty: 0.38709677
p_int: 0.999229072
p_ni: 3.8e-8
p_wrong: 0.000770891
Data Source: BioPlex
UBB
Tbio
Novelty: 0.00895161
p_int: 0.992867794
p_ni: 0.007128948
p_wrong: 0.000003257
Data Source: BioPlex
MYO3B
Tbio
Family: Kinase
Novelty: 0.14793942
p_int: 0.969654657
p_ni: 0.030328796
p_wrong: 0.000016547
Score: 0.273
Data Source: BioPlex,STRINGDB
FBXO30
Tdark
Novelty: 1
p_int: 0.963090989
p_ni: 0.028769161
p_wrong: 0.00813985
Data Source: BioPlex
MYO1B
Tbio
Novelty: 0.01178422
p_int: 0.955429284
p_ni: 0.044570717
Score: 0.192
Data Source: BioPlex,STRINGDB
MYO5A
Tbio
Novelty: 0.00498077
p_int: 0.945151434
p_ni: 0.054848566
Score: 0.305
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  12.14

PubMed score by year
PubTator Score  147.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSG
1-70
TVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDG
70-140
DKNNDGRIDYDEFLEFMKGVE
140-161
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE