You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
VAMP2
Vesicle-associated membrane protein 2

Protein Summary
Description
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000316509
  • ENSP00000314214
  • ENSG00000220205

Symbol
  • SYB2
  • SYB2
  • VAMP-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
disease perturbation
0.95
protein complex
0.94
cellular component
0.89
histone modification site profile
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 348.48   (req: < 5)
Gene RIFs: 32   (req: <= 3)
Antibodies: 265   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 348.48   (req: >= 5)
Gene RIFs: 32   (req: > 3)
Antibodies: 265   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 25
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (68)
Acetylcholine Neurotransmitter Release Cycle (R-HSA-264642)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 38
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine Neurotransmitter Release Cycle
Reactome
Cargo recognition for clathrin-mediated endocytosis
Reactome
Clathrin-mediated endocytosis
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Name
Explore in Pharos
Explore in Source
Acetylcholine Neurotransmitter Release Cycle
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Cytokine Signaling in Immune system
Disease
Gene Ontology Terms (52)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
ParkinsonsUK-UCL
Inferred from Sequence or structural Similarity (ISS)
ParkinsonsUK-UCL
Inferred from Sequence or structural Similarity (ISS)
ParkinsonsUK-UCL
Inferred from Sequence or structural Similarity (ISS)
ParkinsonsUK-UCL
Inferred from Sequence or structural Similarity (ISS)
ParkinsonsUK-UCL
Traceable Author Statement (TAS)
ParkinsonsUK-UCL
Protein-Protein Interactions (383)
1 – 10 of 383
SYPL1
Tbio
Novelty: 0.05288975
p_int: 0.999758124
p_ni: 0.000241876
Score: 0.54
Data Source: BioPlex,STRINGDB
WDFY1
Tbio
Novelty: 0.19843159
p_int: 0.995197026
p_ni: 0.004802974
Score: 0.18
Data Source: BioPlex,STRINGDB
STX7
Tbio
Novelty: 0.052457
p_int: 0.986151277
p_ni: 0.013848723
Score: 0.939
Data Source: BioPlex,STRINGDB
STX12
Tbio
Novelty: 0.07003045
p_int: 0.985251227
p_ni: 0.014748773
Score: 0.97
Data Source: BioPlex,STRINGDB
WASHC1
Tbio
Novelty: 0.1892021
p_int: 0.976419239
p_ni: 0.02358076
p_wrong: 1e-9
Data Source: BioPlex
STX19
Tdark
Novelty: 3.68421053
p_int: 0.941572852
p_ni: 0.058427148
Score: 0.792
Data Source: BioPlex,STRINGDB
TPCN2
Tchem
Family: IC
Novelty: 0.01836974
p_int: 0.884106036
p_ni: 0.115893927
p_wrong: 3.6e-8
Score: 0.156
Data Source: BioPlex,STRINGDB
STX11
Tbio
Novelty: 0.02724724
p_int: 0.881555206
p_ni: 0.118444794
Score: 0.889
Data Source: BioPlex,STRINGDB
MUC1
Tbio
Novelty: 0.00029046
p_int: 0.835239826
p_ni: 0.164759795
p_wrong: 3.79e-7
Score: 0.161
Data Source: BioPlex,STRINGDB
STX3
Tbio
Novelty: 0.01589793
p_int: 0.816612041
p_ni: 0.183387571
p_wrong: 3.87e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  348.48

PubMed score by year
PubTator Score  265.27

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADAL
1-70
QAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
70-116
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST