You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BLCAP
Bladder cancer-associated protein

Protein Summary
Description
May regulate cell proliferation and coordinate apoptosis and cell cycle progression via a novel mechanism independent of both p53/TP53 and NF-kappa-B. This gene encodes a protein that reduces cell growth by stimulating apoptosis. Alternative splicing and the use of alternative promoters result in multiple transcript variants encoding the same protein. This gene is imprinted in brain where different transcript variants are expressed from each parental allele. Transcript variants initiating from the upstream promoter are expressed preferentially from the maternal allele, while transcript variants initiating downstream of the interspersed NNAT gene (GeneID:4826) are expressed from the paternal allele. Transcripts at this locus may also undergo A to I editing, resulting in amino acid changes at three positions in the N-terminus of the protein. [provided by RefSeq, Nov 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373537
  • ENSP00000362637
  • ENSG00000166619
  • ENST00000397131
  • ENSP00000380320
  • ENST00000397134
  • ENSP00000380323
  • ENST00000397135
  • ENSP00000380324
  • ENST00000397137
  • ENSP00000380326
  • ENST00000414542
  • ENSP00000397172
  • ENST00000432507
  • ENSP00000414973
  • ENST00000649668
  • ENSP00000497610

Symbol
  • BC10
  • BC10
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.95
virus perturbation
0.92
transcription factor binding site profile
0.9
transcription factor
0.81
kinase perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.12   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 42   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.12   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 42   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (48)
1 – 10 of 48
NNAT
Tbio
Novelty: 0.00997652
Score: 0.903
Data Source: STRINGDB
LRAT
Tbio
Family: Enzyme
Novelty: 0.02898976
Score: 0.782
Data Source: STRINGDB
CYFIP2
Tbio
Novelty: 0.02778421
Score: 0.649
Data Source: STRINGDB
CTNNBL1
Tbio
Novelty: 0.00789441
Score: 0.641
Data Source: STRINGDB
ATP10A
Tbio
Family: Transporter
Novelty: 0.06155014
Score: 0.637
Data Source: STRINGDB
ANKZF1
Tbio
Novelty: 0.33519553
Score: 0.627
Data Source: STRINGDB
ADAR
Tbio
Family: Enzyme
Novelty: 0.00122438
Score: 0.621
Data Source: STRINGDB
COG3
Tbio
Novelty: 0.06121869
Score: 0.595
Data Source: STRINGDB
CHMP2A
Tbio
Novelty: 0.00337804
Score: 0.587
Data Source: STRINGDB
FBLIM1
Tbio
Novelty: 0.04280121
Score: 0.586
Data Source: STRINGDB
Publication Statistics
PubMed Score  38.12

PubMed score by year
PubTator Score  24.8

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHC
1-70
SDSPLPESAHDPGVVGT
70-87
MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT