You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GNB2
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

Protein Summary
Description
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000303210
  • ENSP00000305260
  • ENSG00000172354
  • ENST00000393924
  • ENSP00000377501
  • ENST00000393926
  • ENSP00000377503
  • ENST00000419828
  • ENSP00000390543
  • ENST00000427895
  • ENSP00000400286
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
pathway
0.93
interacting protein
0.92
protein domain
0.92
disease perturbation
0.9
transcription factor binding site profile
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.72   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 172   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.72   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 172   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (113)
ADP signalling through P2Y purinoceptor 1 (R-HSA-418592)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 59
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ADP signalling through P2Y purinoceptor 1
Reactome
ADP signalling through P2Y purinoceptor 12
Reactome
Activation of G protein gated Potassium channels
Reactome
Activation of GABAB receptors
Reactome
Activation of kainate receptors upon glutamate binding
Name
Explore in Pharos
Explore in Source
ADP signalling through P2Y purinoceptor 1
ADP signalling through P2Y purinoceptor 12
Activation of G protein gated Potassium channels
Activation of GABAB receptors
Activation of kainate receptors upon glutamate binding
Protein-Protein Interactions (637)
1 – 10 of 637
GNG2
Tbio
Novelty: 0.08273543
p_int: 0.999998559
p_ni: 0.000001441
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
GNGT1
Tbio
Novelty: 0.03653174
p_int: 0.999996182
p_ni: 0.000003818
Score: 0.999
Data Source: BioPlex,STRINGDB
GNAS
Tbio
Novelty: 0.00259764
p_int: 0.999981194
p_ni: 0.000018806
Score: 0.962
Data Source: BioPlex,Reactome,STRINGDB
GNAI3
Tbio
Novelty: 0.03936457
p_int: 0.999979578
p_ni: 0.000020422
Score: 0.99
Data Source: BioPlex,STRINGDB
PDCL
Tbio
Novelty: 0.0035385
p_int: 0.999827779
p_ni: 0.000172221
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
PFDN5
Tbio
Novelty: 0.09272547
p_int: 0.996168697
p_ni: 0.003831303
Score: 0.512
Data Source: BioPlex,STRINGDB
GNA13
Tbio
Novelty: 0.05970556
p_int: 0.995439416
p_ni: 0.004560584
Score: 0.959
Data Source: BioPlex,STRINGDB
SLC6A5
Tchem
Family: Transporter
Novelty: 0.00491865
p_int: 0.99535307
p_ni: 0.00464693
Data Source: BioPlex
NTRK3
Tclin
Family: Kinase
Novelty: 0.00241438
p_int: 0.994610679
p_ni: 0.005389321
p_wrong: 1e-9
Score: 0.18
Data Source: BioPlex,STRINGDB
DEFB104A
Tbio
Novelty: 0.05631898
p_int: 0.991422693
p_ni: 0.008577307
Data Source: BioPlex
Publication Statistics
PubMed Score  4.72

PubMed score by year
PubTator Score  4.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLL
1-70
VSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELP
70-140
GHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKL
140-210
WDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSR
210-280
SGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
280-340
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN