You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RAB1A
Ras-related protein Rab-1A

Protein Summary
Description
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell membrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assembly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport. This gene encodes a member of the Ras superfamily of GTPases. Members of ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000398529
  • ENSP00000381540
  • ENSG00000138069
  • ENST00000409784
  • ENSP00000387286
  • ENST00000409892
  • ENSP00000386451
  • ENST00000649427
  • ENSP00000497078

Symbol
  • RAB1
  • RAB1
  • YPT1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
kinase perturbation
0.97
transcription factor binding site profile
0.95
disease perturbation
0.93
biological process
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 276.01   (req: < 5)
Gene RIFs: 41   (req: <= 3)
Antibodies: 154   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 276.01   (req: >= 5)
Gene RIFs: 41   (req: > 3)
Antibodies: 154   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 25
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (11)
1 – 5 of 11
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (23)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 20
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
COPI-dependent Golgi-to-ER retrograde traffic
Reactome
COPI-mediated anterograde transport
Reactome
COPII-mediated vesicle transport
Reactome
Cell Cycle
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
COPI-dependent Golgi-to-ER retrograde traffic
COPI-mediated anterograde transport
COPII-mediated vesicle transport
Cell Cycle
Gene Ontology Terms (33)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (399)
1 – 10 of 399
RAB1B
Tbio
Family: Enzyme
Novelty: 0.02840676
p_int: 1
Score: 0.985
Data Source: BioPlex,STRINGDB
GDI1
Tbio
Novelty: 0.02210681
p_int: 0.999970873
p_ni: 0.000029127
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
CHML
Tbio
Family: Enzyme
Novelty: 0.0116075
p_int: 0.999589494
p_ni: 0.000410506
Score: 0.976
Data Source: BioPlex,Reactome,STRINGDB
RAB8A
Tbio
Family: Enzyme
Novelty: 0.00226947
p_int: 0.999385637
p_ni: 0.00061435
p_wrong: 1.3e-8
Score: 0.983
Data Source: BioPlex,STRINGDB
GDI2
Tbio
Novelty: 0.03351296
p_int: 0.997803131
p_ni: 0.002196869
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
RABIF
Tbio
Novelty: 0.63157895
p_int: 0.996519745
p_ni: 0.003480255
Score: 0.699
Data Source: BioPlex,STRINGDB
VPS13C
Tbio
Novelty: 0.09280821
p_int: 0.995977907
p_ni: 0.004022087
p_wrong: 6e-9
Score: 0.23
Data Source: BioPlex,STRINGDB
CHM
Tbio
Family: Enzyme
Novelty: 0.00301194
p_int: 0.994099611
p_ni: 0.005899966
p_wrong: 4.23e-7
Score: 0.983
Data Source: BioPlex,Reactome,STRINGDB
EEF1A2
Tchem
Novelty: 0.0002261
p_int: 0.972877338
p_ni: 0.027122662
Data Source: BioPlex
RABGGTA
Tbio
Family: Enzyme
Novelty: 0.18518519
p_int: 0.876731226
p_ni: 0.123268774
Score: 0.988
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  276.01

PubMed score by year
PubTator Score  187.93

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQ
1-70
ERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAK
70-140
EFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
140-205
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC