You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RHOB
Rho-related GTP-binding protein RhoB

Protein Summary
Description
Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000272233
  • ENSP00000272233
  • ENSG00000143878

Symbol
  • ARH6
  • ARHB
  • ARH6
  • ARHB
  • RHOH6
  • MST081
  • MSTP081
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
1
transcription factor perturbation
1
kinase perturbation
0.96
molecular function
0.93
small molecule perturbation
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 306.11   (req: < 5)
Gene RIFs: 98   (req: <= 3)
Antibodies: 200   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 306.11   (req: >= 5)
Gene RIFs: 98   (req: > 3)
Antibodies: 200   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 29
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 20
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
G alpha (12/13) signalling events
Reactome
GPCR downstream signalling
Reactome
GPVI-mediated activation cascade
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
G alpha (12/13) signalling events
GPCR downstream signalling
GPVI-mediated activation cascade
Gene Ontology Terms (42)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (323)
1 – 10 of 323
MTRF1
Tbio
Family: Enzyme
Novelty: 0.11938601
p_int: 0.8724693
p_ni: 0.000015365
p_wrong: 0.127515335
Data Source: BioPlex
ALG6
Tbio
Family: Enzyme
Novelty: 0.03417142
p_int: 0.860317692
p_ni: 0.000099779
p_wrong: 0.139582529
Data Source: BioPlex
ARHGDIA
Tchem
Novelty: 0.00267642
Score: 0.991
Data Source: STRINGDB
ARHGDIG
Tbio
Novelty: 0.15662875
Score: 0.989
Data Source: STRINGDB
ARHGAP35
Tbio
Family: Enzyme
Novelty: 0.01196157
Score: 0.987
Data Source: STRINGDB
ARHGAP5
Tbio
Family: Enzyme
Novelty: 0.0530051
Score: 0.983
Data Source: STRINGDB
ARHGEF3
Tbio
Novelty: 0.0438499
Score: 0.982
Data Source: STRINGDB
ARHGDIB
Tbio
Novelty: 0.01122562
Score: 0.98
Data Source: STRINGDB
ARHGEF12
Tbio
Novelty: 0.00213883
Score: 0.979
Data Source: Reactome,STRINGDB
ARHGEF11
Tbio
Novelty: 0.02213023
Score: 0.978
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  306.11

PubMed score by year
PubTator Score  198.59

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR
1-70
PLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVR
70-140
TDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
140-196
MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL