You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
UBE2H
Ubiquitin-conjugating enzyme E2 H

Protein Summary
Description
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins (PubMed:8132613, PubMed:17588522, PubMed:20061386). E2 ubiquitin conjugating enzyme that transfers ubiquitin to MAEA, a core component of the CTLH E3 ubiquitin-protein ligase complex (PubMed:29911972). In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination (PubMed:20061386). Capable, in vitro, to ubiquitinate histone H2A (PubMed:8132613). The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Three alternatively spliced transcript ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000355621
  • ENSP00000347836
  • ENSG00000186591
  • ENST00000473814
  • ENSP00000419097

Symbol
  • GID3
  • UBC8
  • UBCH
  • UBCH2
  • E2-20K
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
kinase perturbation
0.96
molecular function
0.95
virus perturbation
0.88
transcription factor binding site profile
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.11   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 195   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.11   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 195   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing: Ubiquitination & Proteasome degradation
Reactome
Class I MHC mediated antigen processing & presentation
Reactome
Immune System
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing: Ubiquitination & Proteasome degradation
Class I MHC mediated antigen processing & presentation
Immune System
Metabolism of proteins
Protein-Protein Interactions (323)
1 – 10 of 323
UBA3
Tbio
Novelty: 0.05787703
Score: 0.989
Data Source: STRINGDB
UBA1
Tbio
Novelty: 0.00582285
Score: 0.986
Data Source: STRINGDB
UBE2W
Tbio
Novelty: 0.07925276
Score: 0.976
Data Source: STRINGDB
UBE2J1
Tbio
Novelty: 0.05597139
Score: 0.972
Data Source: STRINGDB
UBE2O
Tbio
Novelty: 0.07223942
Score: 0.968
Data Source: STRINGDB
UBE2J2
Tbio
Novelty: 0.25423729
Score: 0.964
Data Source: STRINGDB
UBR2
Tbio
Family: Enzyme
Novelty: 0.03319944
Score: 0.958
Data Source: STRINGDB
UBE2V2
Tbio
Novelty: 0.01761532
Score: 0.958
Data Source: STRINGDB
UBA7
Tbio
Novelty: 0.02293227
Score: 0.954
Data Source: STRINGDB
UBC
Tbio
Novelty: 0.00161137
Score: 0.951
Data Source: STRINGDB
Publication Statistics
PubMed Score  18.11

PubMed score by year
PubTator Score  13.32

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGF
1-70
MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQK
70-140
IKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
140-183
MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL