You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FGF12
Fibroblast growth factor 12

Protein Summary
Description
Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants enco ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000445105
  • ENSP00000393686
  • ENSG00000114279
  • ENST00000450716
  • ENSP00000397635
  • ENST00000454309
  • ENSP00000413496

Symbol
  • FGF12B
  • FHF1
  • FHF1
  • EIEE47
  • FGF12B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.99
microRNA
0.86
virus perturbation
0.79
disease
0.72
phenotype
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 26.55   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 212   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 26.55   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 212   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Cardiac conduction (R-HSA-5576891)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cardiac conduction
Reactome
Muscle contraction
Reactome
Phase 0 - rapid depolarisation
Name
Explore in Pharos
Explore in Source
Cardiac conduction
Muscle contraction
Phase 0 - rapid depolarisation
Protein-Protein Interactions (149)
1 – 10 of 149
RTF1
Tbio
Family: Enzyme
Novelty: 0.03564965
p_int: 0.999999933
p_ni: 6.1e-8
p_wrong: 5e-9
Data Source: BioPlex
MAPK8IP2
Tbio
Family: Enzyme
Novelty: 0.00156267
p_int: 0.999999151
p_ni: 8.49e-7
Score: 0.657
Data Source: BioPlex,STRINGDB
FNBP4
Tdark
Novelty: 0.2068824
p_int: 0.999996759
p_ni: 0.000003241
Data Source: BioPlex
SCN5A
Tclin
Family: IC
Novelty: 0.00065533
p_int: 0.999987629
p_ni: 0.00000231
p_wrong: 0.000010061
Score: 0.918
Data Source: BioPlex,STRINGDB
CTDP1
Tbio
Family: Enzyme
Novelty: 0.01236149
p_int: 0.999986443
p_ni: 0.000001509
p_wrong: 0.000012048
Data Source: BioPlex
AFF4
Tbio
Family: TF
Novelty: 0.00261174
p_int: 0.99996644
p_ni: 0.00003356
Data Source: BioPlex
DCAF16
Tdark
Novelty: 0.96774194
p_int: 0.999913226
p_ni: 0.000086362
p_wrong: 4.12e-7
Data Source: BioPlex
WDR75
Tbio
Novelty: 0.35651969
p_int: 0.999910437
p_ni: 0.000089563
Data Source: BioPlex
GPBP1L1
Tdark
Novelty: 0.23809524
p_int: 0.999882453
p_ni: 0.000110088
p_wrong: 0.000007459
Data Source: BioPlex
CHD9
Tbio
Family: Epigenetic
Novelty: 0.10573131
p_int: 0.99909962
p_ni: 0.000900351
p_wrong: 2.9e-8
Data Source: BioPlex
Publication Statistics
PubMed Score  26.55

PubMed score by year
PubTator Score  27.64

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQL
1-70
KGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDV
70-140
FTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYRE
140-210
PSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
210-243
MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST