You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GPR85
Probable G-protein coupled receptor 85

Protein Summary
Description
Orphan receptor. Members of the G protein-coupled receptor (GPCR) family, such as GPR85, have a similar structure characterized by 7 transmembrane domains. Activation of GPCRs by extracellular stimuli, such as neurotransmitters, hormones, or light, induces an intracellular signaling cascade mediated by heterotrimeric GTP-binding proteins, or G proteins (Matsumoto et al., 2000 [PubMed 10833454]).[supplied by OMIM, Aug 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000297146
  • ENSP00000297146
  • ENSG00000164604
  • ENST00000424100
  • ENSP00000396763
  • ENST00000449591
  • ENSP00000401178
  • ENST00000610164
  • ENSP00000476863

Symbol
  • SREB2
  • SREB
  • SREB2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.84
cell type or tissue
0.68
cell line
0.58
disease perturbation
0.56
tissue
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.22   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 153   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.22   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 153   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
UniProtKB
Protein-Protein Interactions (43)
1 – 10 of 43
INSIG2
Tbio
Novelty: 0.0112459
Score: 0.746
Data Source: STRINGDB
ENC1
Tbio
Novelty: 0.00832731
Score: 0.74
Data Source: STRINGDB
PTCHD3
Tbio
Novelty: 0.00118764
Score: 0.674
Data Source: STRINGDB
NWD2
Tdark
Novelty: 0.14925373
Score: 0.649
Data Source: STRINGDB
INSIG1
Tbio
Novelty: 0.01204839
Score: 0.64
Data Source: STRINGDB
PLAGL2
Tbio
Family: TF
Novelty: 0.02033225
Score: 0.622
Data Source: STRINGDB
GPR61
Tbio
Family: GPCR
Novelty: 0.19525282
Score: 0.618
Data Source: STRINGDB
SNX33
Tbio
Novelty: 0.3156708
Score: 0.609
Data Source: STRINGDB
MYH6
Tbio
Novelty: 0.00088679
Score: 0.602
Data Source: STRINGDB
GNAT3
Tbio
Novelty: 0.004945
Score: 0.597
Data Source: STRINGDB
Publication Statistics
PubMed Score  22.22

PubMed score by year
PubTator Score  8.78

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRS
1-70
AICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLA
70-140
VICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVH
140-210
DRRKMKPVQFVAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKME
210-280
KRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCF
280-350
STTLLYCRKSRLPREPYCVI
350-370
MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCFSTTLLYCRKSRLPREPYCVI