You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
KRTAP12-4
Keratin-associated protein 12-4

Protein Summary
Description
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000391618
  • ENSP00000375476
  • ENSG00000212933

Symbol
  • KAP12.4
  • KRTAP12.4
  • KRTAP12.4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.37
cell line
0.3
tissue
0.29
cellular component
0.25
molecular function
0.15


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (91)
1 – 10 of 91
KRTAP10-11
Tdark
Score: 0.528
Data Source: STRINGDB
KRTAP20-1
Tdark
Novelty: 3
Score: 0.527
Data Source: STRINGDB
KRTAP22-2
Tdark
Score: 0.52
Data Source: STRINGDB
KRTAP19-6
Tdark
Score: 0.52
Data Source: STRINGDB
KRTAP20-3
Tdark
Score: 0.52
Data Source: STRINGDB
KRTAP10-9
Tdark
Score: 0.516
Data Source: STRINGDB
KRTAP23-1
Tdark
Score: 0.514
Data Source: STRINGDB
KRTAP10-8
Tdark
Score: 0.509
Data Source: STRINGDB
KRTAP20-4
Tdark
Score: 0.508
Data Source: STRINGDB
KRTAP9-7
Tdark
Score: 0.507
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MCHTSHSSGCPMACPGSPCCVPSTCYPPEGYGTSCCCSAPCVALLCRPLCGVSTCCQPACCVPSPCQVAC
1-70
CVPVSCKPVLCVASFCPTSGCCQPFCPTLVYRPVTWSTPTGC
70-112
MCHTSHSSGCPMACPGSPCCVPSTCYPPEGYGTSCCCSAPCVALLCRPLCGVSTCCQPACCVPSPCQVACCVPVSCKPVLCVASFCPTSGCCQPFCPTLVYRPVTWSTPTGC