You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ANAPC15
Anaphase-promoting complex subunit 15

Protein Summary
Description
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating in the responsiveness of the spindle assembly checkpoint. Also required for degradation of CDC20.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000227618
  • ENSP00000227618
  • ENSG00000110200
  • ENST00000535234
  • ENSP00000446412
  • ENST00000535503
  • ENSP00000443383
  • ENST00000538393
  • ENSP00000440002
  • ENST00000538919
  • ENSP00000440983
  • ENST00000542531
  • ENSP00000443911
  • ENST00000543587
  • ENSP00000439403
  • ENST00000545680
  • ENSP00000443645
  • ENST00000545944
  • ENSP00000446383

Symbol
  • C11orf51
  • APC15
  • HSPC020
  • C11orf51
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.88
virus perturbation
0.72
cell line
0.66
tissue
0.65
cell type or tissue
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.55   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 32   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.55   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 32   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (33)
APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 33
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APC-Cdc20 mediated degradation of Nek2A
Reactome
APC/C-mediated degradation of cell cycle proteins
Reactome
APC/C:Cdc20 mediated degradation of Cyclin B
Reactome
APC/C:Cdc20 mediated degradation of Securin
Reactome
APC/C:Cdc20 mediated degradation of mitotic proteins
Name
Explore in Pharos
Explore in Source
APC-Cdc20 mediated degradation of Nek2A
APC/C-mediated degradation of cell cycle proteins
APC/C:Cdc20 mediated degradation of Cyclin B
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdc20 mediated degradation of mitotic proteins
Gene Ontology Terms (9)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
LIFEdb
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (135)
1 – 10 of 135
ANAPC2
Tbio
Family: Enzyme
Novelty: 0.25398893
Score: 0.999
Data Source: STRINGDB
ANAPC4
Tbio
Family: Enzyme
Novelty: 1.93548387
Score: 0.999
Data Source: STRINGDB
ANAPC16
Tdark
Family: Enzyme
Novelty: 0.09302326
Score: 0.997
Data Source: STRINGDB
ANAPC10
Tbio
Family: Enzyme
Novelty: 0.04372723
Score: 0.996
Data Source: STRINGDB
ANAPC13
Tbio
Family: Enzyme
Novelty: 0.0994907
Score: 0.995
Data Source: STRINGDB
CDC20
Tbio
Novelty: 0.00237728
Score: 0.994
Data Source: STRINGDB
ANAPC5
Tbio
Family: Enzyme
Novelty: 0.0345899
Score: 0.994
Data Source: STRINGDB
FZR1
Tbio
Novelty: 0.01409033
Score: 0.993
Data Source: STRINGDB
ANAPC11
Tbio
Family: Enzyme
Novelty: 0.04056134
Score: 0.993
Data Source: STRINGDB
CDC26
Tbio
Family: Enzyme
Novelty: 0.12631579
Score: 0.989
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.55

PubMed score by year
PubTator Score  3.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDD
1-70
EDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
70-121
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI