ANAPC15
Anaphase-promoting complex subunit 15
Protein Summary
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating in the responsiveness of the spindle assembly checkpoint. Also required for degradation of CDC20.
- ENST00000227618
- ENSP00000227618
- ENSG00000110200
- ENST00000535234
- ENSP00000446412
- ENST00000535503
- ENSP00000443383
- ENST00000538393
- ENSP00000440002
- ENST00000538919
- ENSP00000440983
- ENST00000542531
- ENSP00000443911
- ENST00000543587
- ENSP00000439403
- ENST00000545680
- ENSP00000443645
- ENST00000545944
- ENSP00000446383
- C11orf51
- APC15
- HSPC020
- C11orf51
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
histone modification site profile | 0.88 | ||
virus perturbation | 0.72 | ||
cell line | 0.66 | ||
tissue | 0.65 | ||
cell type or tissue | 0.56 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 3.55 (req: < 5)
Gene RIFs: 3 (req: <= 3)
Antibodies: 32 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 3.55 (req: >= 5)
Gene RIFs: 3 (req: > 3)
Antibodies: 32 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 5
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (33)
Reactome (33)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 33
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
Reactome | APC-Cdc20 mediated degradation of Nek2A | ||||
Reactome | APC/C-mediated degradation of cell cycle proteins | ||||
Reactome | APC/C:Cdc20 mediated degradation of Cyclin B | ||||
Reactome | APC/C:Cdc20 mediated degradation of Securin | ||||
Reactome | APC/C:Cdc20 mediated degradation of mitotic proteins | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
APC-Cdc20 mediated degradation of Nek2A | ||||
APC/C-mediated degradation of cell cycle proteins | ||||
APC/C:Cdc20 mediated degradation of Cyclin B | ||||
APC/C:Cdc20 mediated degradation of Securin | ||||
APC/C:Cdc20 mediated degradation of mitotic proteins | ||||
Gene Ontology Terms (9)
Components (4)
Processes (5)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | LIFEdb | |||
Traceable Author Statement (TAS) | Reactome | |||
Traceable Author Statement (TAS) | Reactome | |||
Protein-Protein Interactions (135)
1 – 10 of 135
ANAPC2
Family: Enzyme
Novelty: 0.25398893
Score: 0.999
Data Source: STRINGDB
ANAPC4
Family: Enzyme
Novelty: 1.93548387
Score: 0.999
Data Source: STRINGDB
ANAPC16
Family: Enzyme
Novelty: 0.09302326
Score: 0.997
Data Source: STRINGDB
ANAPC10
Family: Enzyme
Novelty: 0.04372723
Score: 0.996
Data Source: STRINGDB
ANAPC13
Family: Enzyme
Novelty: 0.0994907
Score: 0.995
Data Source: STRINGDB
CDC20
Novelty: 0.00237728
Score: 0.994
Data Source: STRINGDB
ANAPC5
Family: Enzyme
Novelty: 0.0345899
Score: 0.994
Data Source: STRINGDB
FZR1
Novelty: 0.01409033
Score: 0.993
Data Source: STRINGDB
ANAPC11
Family: Enzyme
Novelty: 0.04056134
Score: 0.993
Data Source: STRINGDB
CDC26
Family: Enzyme
Novelty: 0.12631579
Score: 0.989
Data Source: STRINGDB
Publication Statistics
PubMed Score 3.55
PubMed score by year
PubTator Score 3.11
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDD
1-70
EDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
70-121
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
Find similar targets by: