You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LILRA4
Leukocyte immunoglobulin-like receptor subfamily A member 4

Protein Classes
Protein Summary
Description
Functions coreceptor to limit the innate immune responses to viral infections; signaling occurs via FCER1G (PubMed:16735691, PubMed:19564354). Down-regulates the production of IFNA1, IFNA2, IFNA4, IFNB1 and TNF by plasmacytoid dendritic cells that have been exposed to influenza virus or cytidine-phosphate-guanosine (CpG) dinucleotides, indicating it functions as negative regulator of TLR7 and TLR9 signaling cascades (PubMed:16735691, PubMed:19564354, PubMed:24586760). Down-regulates interferon production in response to interaction with BST2 on HIV-1 infected cells (PubMed:26172439). Activates a signaling cascade in complex with FCER1G that results in phosphorylation of Src family and Syk kinases and thereby triggers mobilization of intracellular Ca(2+) (PubMed:16735691, PubMed:19564354). Does not interfere with the differentiation of plasmacytoid dendritic cells into antigen-presenting cells (PubMed:24586760). This gene encodes an immunoglobulin-like cell surface protein that is expres ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000291759
  • ENSP00000291759
  • ENSG00000239961
  • ENST00000613813
  • ENSP00000479979
  • ENSG00000277092
  • ENST00000616790
  • ENSP00000483846
  • ENSG00000274185
  • ENST00000619832
  • ENSP00000481073
  • ENSG00000276798

Symbol
  • ILT7
  • ILT7
  • CD85g
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.72
kinase perturbation
0.66
protein domain
0.58
tissue sample
0.57
tissue
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 267   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 267   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (105)
1 – 10 of 105
HLA-G
Tbio
Novelty: 0.00082058
Score: 0.92
Data Source: STRINGDB
HLA-F
Tbio
Novelty: 0.01349191
Score: 0.914
Data Source: STRINGDB
HLA-E
Tbio
Novelty: 0.00263667
Score: 0.91
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.908
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.908
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.908
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.908
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.908
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.908
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.908
Data Source: STRINGDB
Publication Statistics
PubMed Score  8.00

PubMed score by year
PubTator Score  12.71

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTLILTSLLFFGLSLGPRTRVQAENLPKPILWAEPGPVITWHNPVTIWCQGTLEAQGYRLDKEGNSMSRH
1-70
ILKTLESENKVKLSIPSMMWEHAGRYHCYYQSPAGWSEPSDPLELVVTAYSRPTLSALPSPVVTSGVNVT
70-140
LRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPS
140-210
DPLQLLVSGVSRKPSLLTLQGPVVTPGENLTLQCGSDVGYIRYTLYKEGADGLPQRPGRQPQAGLSQANF
210-280
TLSPVSRSYGGQYRCYGAHNVSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPM
280-350
FTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGA
350-420
TETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQHSQRSPPRCSQEANSRKDNAPF
420-490
RVVEPWEQI
490-499
MTLILTSLLFFGLSLGPRTRVQAENLPKPILWAEPGPVITWHNPVTIWCQGTLEAQGYRLDKEGNSMSRHILKTLESENKVKLSIPSMMWEHAGRYHCYYQSPAGWSEPSDPLELVVTAYSRPTLSALPSPVVTSGVNVTLRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSDPLQLLVSGVSRKPSLLTLQGPVVTPGENLTLQCGSDVGYIRYTLYKEGADGLPQRPGRQPQAGLSQANFTLSPVSRSYGGQYRCYGAHNVSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPMFTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGATETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQHSQRSPPRCSQEANSRKDNAPFRVVEPWEQI