You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TAS2R20
Taste receptor type 2 member 20

Protein Summary
Description
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). This gene encodes a member of the taste receptor two family of class C G-protein coupled receptors. Receptors of this family have a short extracellular N-terminus, seven transmembrane helices, three extracellular loops and three intracellular loops, and an intracellular C-terminus. Members of this family are expressed in a subset of taste receptor cells, where they function in bitter taste reception, as well as in non-gustatory cells including those of the brain, reproductive organs, respiratory system, and gastrointestinal system. This gene maps to the taste receptor gene cluster on chromosome 12p13. [provided by RefSeq, Jul 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000538986
  • ENSP00000441624
  • ENSG00000255837
  • ENST00000570941
  • ENSP00000459353
  • ENSG00000273092

Symbol
  • TAS2R49
  • T2R20
  • T2R49
  • T2R56
  • TAS2R49
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.58
microRNA
0.55
tissue sample
0.52
tissue
0.48
pathway
0.44


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.23   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 79   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.23   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 79   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (235)
1 – 10 of 235
TAS1R1
Tbio
Family: GPCR
Novelty: 0.0152692
Score: 0.946
Data Source: STRINGDB
TAS1R2
Tbio
Family: GPCR
Novelty: 0.00853435
Score: 0.946
Data Source: STRINGDB
TAS1R3
Tbio
Family: GPCR
Novelty: 0.0050744
Score: 0.944
Data Source: STRINGDB
GNAT3
Tbio
Novelty: 0.004945
Score: 0.927
Data Source: STRINGDB
TAS2R39
Tbio
Family: GPCR
Novelty: 0.14484423
Score: 0.924
Data Source: STRINGDB
TAS2R4
Tbio
Family: GPCR
Novelty: 0.04115092
Score: 0.923
Data Source: STRINGDB
LPAR5
Tchem
Family: GPCR
Novelty: 0.02957489
Score: 0.923
Data Source: STRINGDB
TAS2R60
Tdark
Family: GPCR
Novelty: 0.97297297
Score: 0.923
Data Source: STRINGDB
TAS2R5
Tbio
Family: GPCR
Novelty: 0.13852935
Score: 0.921
Data Source: STRINGDB
TAS2R16
Tbio
Family: GPCR
Novelty: 0.03546057
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.23

PubMed score by year
PubTator Score  1.33

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLWVILLHWYSTV
1-70
LNPTSSNLKVIIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHHLKRKAKSVVLVIVLGSLFFL
70-140
VCHLVMKHTYINVWTEECEGNVTWKIKLRNAMHLSNLTVAMLANLIPFTLTLISFLLLIYSLCKHLKKMQ
140-210
LHGKGSQDPSTKIHIKALQTVTSFLILLAIYFLCLIISFWNFKMRPKEIVLMLCQAFGIIYPSFHSFILI
210-280
WGNKTLKQTFLSVLWQVTCWAKGQNQSTP
280-309
MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLWVILLHWYSTVLNPTSSNLKVIIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHHLKRKAKSVVLVIVLGSLFFLVCHLVMKHTYINVWTEECEGNVTWKIKLRNAMHLSNLTVAMLANLIPFTLTLISFLLLIYSLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAIYFLCLIISFWNFKMRPKEIVLMLCQAFGIIYPSFHSFILIWGNKTLKQTFLSVLWQVTCWAKGQNQSTP