You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TAS2R19
Taste receptor type 2 member 19

Protein Summary
Description
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000390673
  • ENSP00000375091
  • ENSG00000212124
  • ENST00000573562
  • ENSP00000461533
  • ENSG00000263028

Symbol
  • TAS2R23
  • TAS2R48
  • T2R19
  • T2R23
  • T2R48
  • MSTP058
  • TAS2R23
  • TAS2R48
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.61
tissue sample
0.49
pathway
0.44
tissue
0.41
phenotype
0.37


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.53   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 25   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.53   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 25   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (233)
1 – 10 of 233
TAS1R1
Tbio
Family: GPCR
Novelty: 0.0152692
Score: 0.947
Data Source: STRINGDB
TAS1R3
Tbio
Family: GPCR
Novelty: 0.0050744
Score: 0.946
Data Source: STRINGDB
TAS1R2
Tbio
Family: GPCR
Novelty: 0.00853435
Score: 0.943
Data Source: STRINGDB
GNAT3
Tbio
Novelty: 0.004945
Score: 0.936
Data Source: STRINGDB
TAS2R16
Tbio
Family: GPCR
Novelty: 0.03546057
Score: 0.926
Data Source: STRINGDB
TAS2R60
Tdark
Family: GPCR
Novelty: 0.97297297
Score: 0.925
Data Source: STRINGDB
TAS2R4
Tbio
Family: GPCR
Novelty: 0.04115092
Score: 0.924
Data Source: STRINGDB
TAS2R38
Tbio
Family: GPCR
Novelty: 0.00547147
Score: 0.924
Data Source: STRINGDB
TAS2R41
Tdark
Family: GPCR
Novelty: 1.05263158
Score: 0.922
Data Source: STRINGDB
TAS2R39
Tbio
Family: GPCR
Novelty: 0.14484423
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.53

PubMed score by year
PubTator Score  3.06

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MMCFLLIISSILVVFAFVLGNVANGFIALVNVIDWVNTRKISSAEQILTALVVSRIGLLWVMLFLWYATV
1-70
FNSALYGLEVRIVASNAWAVTNHFSMWLAASLSIFCLLKIANFSNLISLHLKKRIKSVVLVILLGPLVFL
70-140
ICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTTLANLIPFTLSLICFLLLICSLCKHLKKMR
140-210
LHSKGSQDPSTKVHIKALQTVTSFLMLFAIYFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILI
210-280
MGSRKLKQTFLSVLWQMTR
280-299
MMCFLLIISSILVVFAFVLGNVANGFIALVNVIDWVNTRKISSAEQILTALVVSRIGLLWVMLFLWYATVFNSALYGLEVRIVASNAWAVTNHFSMWLAASLSIFCLLKIANFSNLISLHLKKRIKSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTTLANLIPFTLSLICFLLLICSLCKHLKKMRLHSKGSQDPSTKVHIKALQTVTSFLMLFAIYFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILIMGSRKLKQTFLSVLWQMTR