You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TAS2R31
Taste receptor type 2 member 31

Protein Summary
Description
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). Activated by the sulfonyl amide sweeteners saccharin and acesulfame K. TAS2R44 belongs to the large TAS2R receptor family. TAS2Rs are expressed on the surface of taste receptor cells and mediate the perception of bitterness through a G protein-coupled second messenger pathway (Conte et al., 2002 [PubMed 12584440]). For further information on TAS2Rs, see MIM 604791.[supplied by OMIM, Mar 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000390675
  • ENSP00000375093
  • ENSG00000256436
  • ENST00000572376
  • ENSP00000459810
  • ENSG00000263097

Symbol
  • TAS2R44
  • T2R31
  • T2R44
  • T2R53
  • TAS2R44
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.68
cell line
0.65
cell type or tissue
0.61
tissue
0.61
chemical
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.85   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 70   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.85   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 70   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (233)
1 – 10 of 233
GNAT3
Tbio
Novelty: 0.004945
Score: 0.965
Data Source: STRINGDB
TAS1R3
Tbio
Family: GPCR
Novelty: 0.0050744
Score: 0.948
Data Source: STRINGDB
TAS1R2
Tbio
Family: GPCR
Novelty: 0.00853435
Score: 0.946
Data Source: STRINGDB
TAS1R1
Tbio
Family: GPCR
Novelty: 0.0152692
Score: 0.94
Data Source: STRINGDB
TAS2R16
Tbio
Family: GPCR
Novelty: 0.03546057
Score: 0.93
Data Source: STRINGDB
CASR
Tclin
Family: GPCR
Novelty: 0.00066875
Score: 0.93
Data Source: STRINGDB
TAS2R4
Tbio
Family: GPCR
Novelty: 0.04115092
Score: 0.926
Data Source: STRINGDB
TAS2R38
Tbio
Family: GPCR
Novelty: 0.00547147
Score: 0.926
Data Source: STRINGDB
TAS2R39
Tbio
Family: GPCR
Novelty: 0.14484423
Score: 0.922
Data Source: STRINGDB
TAS2R5
Tbio
Family: GPCR
Novelty: 0.13852935
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  6.85

PubMed score by year
PubTator Score  11.08

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MTTFIPIIFSSVVVVLFVIGNFANGFIALVNSIERVKRQKISFADQILTALAVSRVGLLWVLLLNWYSTV
1-70
FNPAFYSVEVRTTAYNVWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLHLKRRVKSVILVMLLGPLLFL
70-140
ACQLFVINMKEIVRTKEYEGNLTWKIKLRSAVYLSDATVTTLGNLVPFTLTLLCFLLLICSLCKHLKKMQ
140-210
LHGKGSQDPSTKVHIKALQTVIFFLLLCAVYFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILI
210-280
WGNKKLKQTFLSVLRQVRYWVKGEKPSSP
280-309
MTTFIPIIFSSVVVVLFVIGNFANGFIALVNSIERVKRQKISFADQILTALAVSRVGLLWVLLLNWYSTVFNPAFYSVEVRTTAYNVWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLHLKRRVKSVILVMLLGPLLFLACQLFVINMKEIVRTKEYEGNLTWKIKLRSAVYLSDATVTTLGNLVPFTLTLLCFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVIFFLLLCAVYFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVLRQVRYWVKGEKPSSP