You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TAS2R41
Taste receptor type 2 member 41

Protein Summary
Description
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). This gene encodes a member of the bitter taste receptor family which belong to the G protein-coupled receptor superfamily and are predominantly expressed in taste receptor cells of the tongue and palate epithelia. This intronless taste receptor gene encodes a seven-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered together with eight other taste receptor genes on chromosome 7. Chloramphenicol is an agonist for the encoded protein. [provided by RefSeq, Jul 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000408916
  • ENSP00000386201
  • ENSG00000221855
  • ENST00000646750
  • ENSP00000494656
  • ENSG00000284982

Symbol
  • T2R41
  • T2R59
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.5
cell line
0.44
cell type or tissue
0.41
cellular component
0.41
pathway
0.35


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.4   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 87   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.4   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 87   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (247)
1 – 10 of 247
PAK1
Tchem
Family: Kinase
Novelty: 0.00303351
p_int: 0.999539955
p_ni: 0.000442458
p_wrong: 0.000017587
Score: 0.219
Data Source: BioPlex,STRINGDB
CBFB
Tchem
Family: TF
Novelty: 0.08455808
p_int: 0.998513795
p_ni: 0.001433171
p_wrong: 0.000053035
Score: 0.209
Data Source: BioPlex,STRINGDB
SNX3
Tbio
Novelty: 0.04222945
p_int: 0.986778968
p_ni: 0.013217269
p_wrong: 0.000003762
Data Source: BioPlex
SCRN2
Tdark
Family: Enzyme
p_int: 0.983695007
p_ni: 0.016068258
p_wrong: 0.000236735
Score: 0.165
Data Source: BioPlex,STRINGDB
MECR
Tbio
Family: Enzyme
Novelty: 0.01953549
p_int: 0.980293706
p_ni: 0.008610509
p_wrong: 0.011095785
Score: 0.332
Data Source: BioPlex,STRINGDB
YKT6
Tbio
Novelty: 0.02242328
p_int: 0.955607738
p_ni: 0.04439211
p_wrong: 1.53e-7
Score: 0.183
Data Source: BioPlex,STRINGDB
CHRAC1
Tdark
Novelty: 0.34141715
p_int: 0.919780037
p_ni: 0.079853569
p_wrong: 0.000366393
Score: 0.189
Data Source: BioPlex,STRINGDB
SERPINB1
Tbio
Family: Enzyme
Novelty: 0.00240968
p_int: 0.882933604
p_ni: 0.111485424
p_wrong: 0.005580972
Score: 0.177
Data Source: BioPlex,STRINGDB
FAHD2A
Tdark
Family: Enzyme
Novelty: 0.68965517
p_int: 0.84938729
p_ni: 0.150580164
p_wrong: 0.000032546
Score: 0.189
Data Source: BioPlex,STRINGDB
LASP1
Tbio
Novelty: 0.01091016
p_int: 0.848995986
p_ni: 0.151004008
p_wrong: 7e-9
Score: 0.183
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  1.40

PubMed score by year
PubTator Score  0.87

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQLVGTVHNFYYS
1-70
AQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHSTFLWLKWRFPGWVPWLLLGSVLI
70-140
SFIITLLFFWVNYPVYQEFLIRKFSGNMTYKWNTRIETYYFPSLKLVIWSIPFSVFLVSIMLLINSLRRH
140-210
TQRMQHNGHSLQDPSTQAHTRALKSLISFLILYALSFLSLIIDAAKFISMQNDFYWPWQIAVYLCISVHP
210-280
FILIFSNLKLRSVFSQLLLLARGFWVA
280-307
MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQLVGTVHNFYYSAQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHSTFLWLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPVYQEFLIRKFSGNMTYKWNTRIETYYFPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFLILYALSFLSLIIDAAKFISMQNDFYWPWQIAVYLCISVHPFILIFSNLKLRSVFSQLLLLARGFWVA