You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TAS2R40
Taste receptor type 2 member 40

Protein Summary
Description
Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. This gene encodes a member of the bitter taste receptor family which belong to the G protein-coupled receptor superfamily and are predominantly expressed in taste receptor cells of the tongue and palate epithelia. This intronless taste receptor gene encodes a seven-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered together with eight other taste receptor genes on chromosome 7. A decrease in the expression of this gene is associated with hypogeusia. [provided by RefSeq, Jul 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000408947
  • ENSP00000386210
  • ENSG00000221937

Symbol
  • GPR60
  • GPR60
  • T2R40
  • T2R58
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.71
metabolite
0.45
cell line
0.4
tissue
0.37
pathway
0.35


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.11   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 11   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.11   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 11   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (234)
1 – 10 of 234
GNAT3
Tbio
Novelty: 0.004945
Score: 0.95
Data Source: STRINGDB
TAS1R2
Tbio
Family: GPCR
Novelty: 0.00853435
Score: 0.949
Data Source: STRINGDB
CASR
Tclin
Family: GPCR
Novelty: 0.00066875
Score: 0.945
Data Source: STRINGDB
TAS1R1
Tbio
Family: GPCR
Novelty: 0.0152692
Score: 0.942
Data Source: STRINGDB
TAS1R3
Tbio
Family: GPCR
Novelty: 0.0050744
Score: 0.942
Data Source: STRINGDB
LPAR5
Tchem
Family: GPCR
Novelty: 0.02957489
Score: 0.936
Data Source: STRINGDB
GRM4
Tchem
Family: GPCR
Novelty: 0.00432322
Score: 0.934
Data Source: STRINGDB
TAS2R31
Tchem
Family: GPCR
Novelty: 0.15665796
Score: 0.921
Data Source: STRINGDB
S1PR4
Tclin
Family: GPCR
Novelty: 0.01383323
Score: 0.921
Data Source: STRINGDB
TAS2R38
Tbio
Family: GPCR
Novelty: 0.00547147
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.11

PubMed score by year
PubTator Score  1.08

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MATVNTDATDKDISKFKVTFTLVVSGIECITGILGSGFITAIYGAEWARGKTLPTGDRIMLMLSFSRLLL
1-70
QIWMMLENIFSLLFRIVYNQNSVYILFKVITVFLNHSNLWFAAWLKVFYCLRIANFNHPLFFLMKRKIIV
70-140
LMPWLLRLSVLVSLSFSFPLSRDVFNVYVNSSIPIPSSNSTEKKYFSETNMVNLVFFYNMGIFVPLIMFI
140-210
LAATLLILSLKRHTLHMGSNATGSRDPSMKAHIGAIKATSYFLILYIFNAIALFLSTSNIFDTYSSWNIL
210-280
CKIIMAAYPAGHSVQLILGNPGLRRAWKRFQHQVPLYLKGQTL
280-323
MATVNTDATDKDISKFKVTFTLVVSGIECITGILGSGFITAIYGAEWARGKTLPTGDRIMLMLSFSRLLLQIWMMLENIFSLLFRIVYNQNSVYILFKVITVFLNHSNLWFAAWLKVFYCLRIANFNHPLFFLMKRKIIVLMPWLLRLSVLVSLSFSFPLSRDVFNVYVNSSIPIPSSNSTEKKYFSETNMVNLVFFYNMGIFVPLIMFILAATLLILSLKRHTLHMGSNATGSRDPSMKAHIGAIKATSYFLILYIFNAIALFLSTSNIFDTYSSWNILCKIIMAAYPAGHSVQLILGNPGLRRAWKRFQHQVPLYLKGQTL