You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TAS2R38
Taste receptor type 2 member 38

Protein Summary
Description
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). This gene encodes a seven-transmembrane G protein-coupled receptor that controls the ability to taste glucosinolates, a family of bitter-tasting compounds found in plants of the Brassica sp. Synthetic compounds phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP) have been identified as ligands for this receptor and have been used to test the genetic diversity of this gene. Although several allelic forms of this gene have been identified worldwide, there are two predominant common forms (taster and non-taster) found outside of Africa. These alleles differ at three nucleotide positions resulting in amino acid changes in the protein (A49P, A262V, and V296I) with the amino acid ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000547270
  • ENSP00000448219
  • ENSG00000257138

Symbol
  • PTC
  • PTC
  • T2R38
  • T2R61
  • THIOT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue
0.63
biological term
0.61
tissue sample
0.57
cell line
0.55
phenotype
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 185.33   (req: < 5)
Gene RIFs: 84   (req: <= 3)
Antibodies: 113   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 185.33   (req: >= 5)
Gene RIFs: 84   (req: > 3)
Antibodies: 113   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (261)
1 – 10 of 261
RNF181
Tbio
Family: Enzyme
Novelty: 0.33426184
p_int: 0.976900171
p_ni: 0.022303416
p_wrong: 0.000796413
Data Source: BioPlex
DUSP14
Tbio
Family: Enzyme
Novelty: 0.06597118
p_int: 0.764779449
p_ni: 0.235217964
p_wrong: 0.000002588
Data Source: BioPlex
TAS2R16
Tbio
Family: GPCR
Novelty: 0.03546057
Score: 0.985
Data Source: STRINGDB
TAS1R2
Tbio
Family: GPCR
Novelty: 0.00853435
Score: 0.971
Data Source: STRINGDB
GNAT3
Tbio
Novelty: 0.004945
Score: 0.97
Data Source: STRINGDB
TAS1R3
Tbio
Family: GPCR
Novelty: 0.0050744
Score: 0.966
Data Source: STRINGDB
TAS1R1
Tbio
Family: GPCR
Novelty: 0.0152692
Score: 0.965
Data Source: STRINGDB
P2RY12
Tclin
Family: GPCR
Novelty: 0.00057146
Score: 0.961
Data Source: STRINGDB
SSTR3
Tclin
Family: GPCR
Novelty: 0.00379402
Score: 0.954
Data Source: STRINGDB
P2RY13
Tchem
Family: GPCR
Novelty: 0.03338395
Score: 0.951
Data Source: STRINGDB
Publication Statistics
PubMed Score  185.33

PubMed score by year
PubTator Score  157.13

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGL
1-70
LFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKI
70-140
SQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFL
140-210
VSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVM
210-280
VCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC
280-333
MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC