You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SESN3
Sestrin-3

Protein Summary
Description
May function as an intracellular leucine sensor that negatively regulates the TORC1 signaling pathway (PubMed:25263562). May also regulate the insulin-receptor signaling pathway through activation of TORC2 (By similarity). This metabolic regulator may also play a role in protection against oxidative and genotoxic stresses (By similarity). This gene encodes a member of the sestrin family of stress-induced proteins. The encoded protein reduces the levels of intracellular reactive oxygen species induced by activated Ras downstream of RAC-alpha serine/threonine-protein kinase (Akt) and FoxO transcription factor. The protein is required for normal regulation of blood glucose, insulin resistance and plays a role in lipid storage in obesity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000278499
  • ENSP00000278499
  • ENSG00000149212
  • ENST00000416495
  • ENSP00000407008
  • ENST00000536441
  • ENSP00000441927

Symbol
  • SEST3
  • SEST3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.94
virus perturbation
0.88
transcription factor binding site profile
0.83
histone modification site profile
0.75
transcription factor
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.5   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 190   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.5   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 190   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (95)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Reactome
TP53 Regulates Metabolic Genes
Reactome
Transcriptional Regulation by TP53
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
TP53 Regulates Metabolic Genes
Transcriptional Regulation by TP53
Protein-Protein Interactions (51)
1 – 10 of 51
ZFP1
Tbio
Family: TF
Novelty: 0.03778162
p_int: 0.999603725
p_ni: 0.000195011
p_wrong: 0.000201264
Score: 0.461
Data Source: BioPlex,STRINGDB
MYCBP2
Tbio
Family: Enzyme
Novelty: 0.00336142
p_int: 0.904731709
p_ni: 0.095268286
p_wrong: 4e-9
Score: 0.28
Data Source: BioPlex,STRINGDB
PRDX1
Tbio
Novelty: 0.00234504
Score: 0.935
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.933
Data Source: STRINGDB
PRKAB1
Tchem
Family: Kinase
Novelty: 0.027886
Score: 0.912
Data Source: STRINGDB
PRKAG2
Tbio
Family: Enzyme
Novelty: 0.00943315
Score: 0.909
Data Source: STRINGDB
PRKAB2
Tchem
Family: Enzyme
Novelty: 0.05936112
Score: 0.909
Data Source: STRINGDB
PRKAA2
Tchem
Family: Kinase
Novelty: 0.03339241
Score: 0.906
Data Source: STRINGDB
PRKAA1
Tclin
Family: Kinase
Novelty: 0.01012358
Score: 0.905
Data Source: STRINGDB
SESN2
Tbio
Novelty: 0.00594978
Score: 0.903
Data Source: STRINGDB
Publication Statistics
PubMed Score  17.50

PubMed score by year
PubTator Score  16.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNRGGGSPSAAANYLLCTNCRKVLRKDKRIRVSQPLTRGPSAFIPEKEVVQANTVDERTNFLVEEYSTSG
1-70
RLDNITQVMSLHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQCSYLINMHVDEFLKTGGIAE
70-140
WLNGLEYVPQRLKNLNEINKLLAHRPWLITKEHIQKLVKTGENNWSLPELVHAVVLLAHYHALASFVFGS
140-210
GINPERDPEISNGFRLISVNNFCVCDLANDNNIENASLSGSNFGIVDSLSELEALMERMKRLQEEREDEE
210-280
ASQEEMSTRFEKEKKESLFVVSGDTFHSFPHSDFEDDMIITSDVSRYIEDPGFGYEDFARRGEEHLPTFR
280-350
AQDYTWENHGFSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMFGIRYDDY
350-420
DYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITRH
420-490
LT
490-492
MNRGGGSPSAAANYLLCTNCRKVLRKDKRIRVSQPLTRGPSAFIPEKEVVQANTVDERTNFLVEEYSTSGRLDNITQVMSLHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQCSYLINMHVDEFLKTGGIAEWLNGLEYVPQRLKNLNEINKLLAHRPWLITKEHIQKLVKTGENNWSLPELVHAVVLLAHYHALASFVFGSGINPERDPEISNGFRLISVNNFCVCDLANDNNIENASLSGSNFGIVDSLSELEALMERMKRLQEEREDEEASQEEMSTRFEKEKKESLFVVSGDTFHSFPHSDFEDDMIITSDVSRYIEDPGFGYEDFARRGEEHLPTFRAQDYTWENHGFSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMFGIRYDDYDYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITRHLT