You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SESN2
Sestrin-2

Protein Summary
Description
Functions as an intracellular leucine sensor that negatively regulates the TORC1 signaling pathway through the GATOR complex. In absence of leucine, binds the GATOR subcomplex GATOR2 and prevents TORC1 signaling (PubMed:18692468, PubMed:25263562, PubMed:25457612, PubMed:26449471, PubMed:26612684, PubMed:26586190). Binding of leucine to SESN2 disrupts its interaction with GATOR2 thereby activating the TORC1 signaling pathway (PubMed:26449471, PubMed:26586190). This stress-inducible metabolic regulator also plays a role in protection against oxidative and genotoxic stresses. May negatively regulate protein translation in response to endoplasmic reticulum stress, via TORC1 (PubMed:24947615). May positively regulate the transcription by NFE2L2 of genes involved in the response to oxidative stress by facilitating the SQSTM1-mediated autophagic degradation of KEAP1 (PubMed:23274085). May also mediate TP53 inhibition of TORC1 signaling upon genotoxic stress (PubMed:18692468). Has an alkylhydr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000253063
  • ENSP00000253063
  • ENSG00000130766
  • ENST00000645231
  • ENSP00000496365
  • ENSG00000285069

Symbol
  • Hi95
  • SEST2
  • HI95
  • SES2
  • SEST2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.82
biological process
0.79
kinase perturbation
0.76
tissue sample
0.73
disease
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 173.5   (req: < 5)
Gene RIFs: 47   (req: <= 3)
Antibodies: 235   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 173.5   (req: >= 5)
Gene RIFs: 47   (req: > 3)
Antibodies: 235   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 32
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Reactome
TP53 Regulates Metabolic Genes
Reactome
Transcriptional Regulation by TP53
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
TP53 Regulates Metabolic Genes
Transcriptional Regulation by TP53
Protein-Protein Interactions (102)
1 – 10 of 102
DHX57
Tdark
Family: Enzyme
Novelty: 1.71428571
p_int: 0.999995958
p_ni: 0.000003725
p_wrong: 3.17e-7
Score: 0.189
Data Source: BioPlex,STRINGDB
WDR5
Tchem
Novelty: 0.00689807
p_int: 0.999992109
p_ni: 0.000007882
p_wrong: 9e-9
Score: 0.163
Data Source: BioPlex,STRINGDB
SEC13
Tbio
Novelty: 0.0100577
p_int: 0.999834631
p_ni: 0.000133122
p_wrong: 0.000032247
Score: 0.902
Data Source: BioPlex,STRINGDB
WDR24
Tdark
Novelty: 1.44736842
Score: 0.999
Data Source: STRINGDB
MIOS
Tdark
Novelty: 0.03378873
Score: 0.999
Data Source: STRINGDB
WDR59
Tdark
Novelty: 0.27755881
Score: 0.999
Data Source: STRINGDB
NPRL2
Tbio
Family: Enzyme
Novelty: 0.04015797
Score: 0.997
Data Source: Reactome,STRINGDB
NPRL3
Tbio
Family: Enzyme
Novelty: 0.00771433
Score: 0.997
Data Source: Reactome,STRINGDB
SZT2
Tbio
Novelty: 0.10810811
Score: 0.994
Data Source: Reactome,STRINGDB
PRDX1
Tbio
Novelty: 0.00234504
Score: 0.983
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  173.50

PubMed score by year
PubTator Score  72.15

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEAL
1-70
MSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTG
70-140
GDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSF
140-210
VFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQ
210-280
EEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYS
280-350
LIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN
350-420
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT
420-480
MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT