You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
RIPK4
Receptor-interacting serine/threonine-protein kinase 4

Protein Summary
Description
Involved in stratified epithelial development. It is a direct transcriptional target of TP63. Plays a role in NF-kappa-B activation. The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000332512
  • ENSP00000332454
  • ENSG00000183421
  • ENST00000352483
  • ENSP00000330161

Symbol
  • ANKRD3
  • DIK
  • DIK
  • PKK
  • PPS2
  • RIP4
  • ANKK2
  • NKRD3
  • ANKRD3
  • CHANDS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.78
virus perturbation
0.68
gene perturbation
0.67
transcription factor binding site profile
0.67
transcription factor perturbation
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 109.48   (req: < 5)
Gene RIFs: 26   (req: <= 3)
Antibodies: 284   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 109.48   (req: >= 5)
Gene RIFs: 26   (req: > 3)
Antibodies: 284   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL603469
chemical structure image
Pathways (172)
Items per page:
1 – 5 of 172
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Pancreatic adenocarcinoma pathway
WikiPathways
Pancreatic adenocarcinoma pathway
WikiPathways
Pancreatic adenocarcinoma pathway
WikiPathways
Pancreatic adenocarcinoma pathway
WikiPathways
Pancreatic adenocarcinoma pathway
Name
Explore in Pharos
Explore in Source
Pancreatic adenocarcinoma pathway
Pancreatic adenocarcinoma pathway
Pancreatic adenocarcinoma pathway
Pancreatic adenocarcinoma pathway
Pancreatic adenocarcinoma pathway
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (87)
1 – 10 of 87
HIF1AN
Tbio
Novelty: 0.01079184
p_int: 0.999990302
p_ni: 0.000009698
Score: 0.236
Data Source: BioPlex,STRINGDB
SPATA5L1
Tdark
Family: Enzyme
Novelty: 1.5
p_int: 0.999988651
p_ni: 0.000011335
p_wrong: 1.4e-8
Score: 0.292
Data Source: BioPlex,STRINGDB
HAVCR2
Tbio
Novelty: 0.00217571
p_int: 0.999841692
p_ni: 0.000158308
Data Source: BioPlex
PID1
Tbio
Novelty: 0.01523772
p_int: 0.997750286
p_ni: 0.002094156
p_wrong: 0.000155558
Data Source: BioPlex
CD79B
Tclin
Novelty: 0.00265318
p_int: 0.986172484
p_ni: 0.013820073
p_wrong: 0.000007444
Data Source: BioPlex
ENPP6
Tbio
Family: Enzyme
Novelty: 0.104096
p_int: 0.984391631
p_ni: 0.015606912
p_wrong: 0.000001457
Score: 0.18
Data Source: BioPlex,STRINGDB
BBS7
Tbio
Novelty: 0.06755563
p_int: 0.971593378
p_ni: 0.007095042
p_wrong: 0.02131158
Data Source: BioPlex
AGT
Tbio
Novelty: 0.00056146
p_int: 0.968270485
p_ni: 0.029067675
p_wrong: 0.002661841
Score: 0.209
Data Source: BioPlex,STRINGDB
ACVR2B
Tchem
Family: Kinase
Novelty: 0.00693595
p_int: 0.961648176
p_ni: 0.037091852
p_wrong: 0.001259972
Data Source: BioPlex
AVIL
Tbio
Novelty: 0.01112118
p_int: 0.959287208
p_ni: 0.028834041
p_wrong: 0.011878751
Data Source: BioPlex
Publication Statistics
PubMed Score  109.48

PubMed score by year
PubTator Score  35.08

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEGDGGTPWALALLRTFDAGEFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEA
1-70
KKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLL
70-140
HLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFA
140-210
IVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNG
210-280
LNGELIRQVLAALLPVTGRWRSPGEGFRLESEVIIRVTCPLSSPQEITSETEDLCEKPDDEVKETAHDLD
280-350
VKSPPEPRSEVVPARLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRSSSESKLPSSGSGKRLS
350-420
GVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVDLALDSGASLL
420-490
HLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLARKISVNAKDEDQWTALHFAA
490-560
QNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGH
560-630
LPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTST
630-700
ARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEEL
700-770
VSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT
770-832
MEGDGGTPWALALLRTFDAGEFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNGLNGELIRQVLAALLPVTGRWRSPGEGFRLESEVIIRVTCPLSSPQEITSETEDLCEKPDDEVKETAHDLDVKSPPEPRSEVVPARLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRSSSESKLPSSGSGKRLSGVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVDLALDSGASLLHLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLARKISVNAKDEDQWTALHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT